| Product Number |
ARP79530_P050 |
| Product Page |
www.avivasysbio.com/cp-antibody-middle-region-arp79530-p050.html |
| Name |
CP Antibody - middle region (ARP79530_P050) |
| Protein Size (# AA) |
1065 amino acids |
| Molecular Weight |
122 kDa |
| NCBI Gene Id |
1356 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
ceruloplasmin (ferroxidase) |
| Alias Symbols |
CP-2 |
| Peptide Sequence |
Synthetic peptide located within the following region: NKGAYPLSIEPIGVRFNKNNEGTYYSPNYNPQSRSVPPSASHVAPTETFT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene is a metalloprotein that binds most of the copper in plasma and is involved in the peroxidation of Fe(II)transferrin to Fe(III) transferrin. Mutations in this gene cause aceruloplasminemia, which results in iron accumulation and tissue damage, and is associated with diabetes and neurologic abnormalities. Two transcript variants, one protein-coding and the other not protein-coding, have been found for this gene. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CP (ARP79530_P050) antibody |
| Blocking Peptide |
For anti-CP (ARP79530_P050) antibody is Catalog # AAP79530 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CP |
| Uniprot ID |
P00450 |
| Protein Name |
ceruloplasmin |
| Protein Accession # |
NP_000087.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_000096.3 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CP |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human Lung Tumor
 | Host: Rabbit
Target Name: CP
Sample Tissue: Human Lung Tumor lysates
Antibody Dilution: 1ug/ml |
|
|
