Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP79530_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

CP Antibody - middle region (ARP79530_P050)

Rating:
100% of 100
Catalog#: ARP79530_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-135866 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CP
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: NKGAYPLSIEPIGVRFNKNNEGTYYSPNYNPQSRSVPPSASHVAPTETFT
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CP (ARP79530_P050) antibody is Catalog # AAP79530
Datasheets/Manuals Printable datasheet for anti-CP (ARP79530_P050) antibody
Gene Symbol CP
Official Gene Full Name ceruloplasmin (ferroxidase)
Alias Symbols CP-2
NCBI Gene Id 1356
Protein Name ceruloplasmin
Description of Target The protein encoded by this gene is a metalloprotein that binds most of the copper in plasma and is involved in the peroxidation of Fe(II)transferrin to Fe(III) transferrin. Mutations in this gene cause aceruloplasminemia, which results in iron accumulation and tissue damage, and is associated with diabetes and neurologic abnormalities. Two transcript variants, one protein-coding and the other not protein-coding, have been found for this gene.
Swissprot Id P00450
Protein Accession # NP_000087.1
Nucleotide Accession # NM_000096.3
Protein Size (# AA) 1065
Molecular Weight 122 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CP.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CP.
  1. What is the species homology for "CP Antibody - middle region (ARP79530_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "CP Antibody - middle region (ARP79530_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 business days".

  3. What buffer format is "CP Antibody - middle region (ARP79530_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CP Antibody - middle region (ARP79530_P050)"?

    This target may also be called "CP-2" in publications.

  5. What is the shipping cost for "CP Antibody - middle region (ARP79530_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CP Antibody - middle region (ARP79530_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CP Antibody - middle region (ARP79530_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "122 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CP Antibody - middle region (ARP79530_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CP"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CP"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CP"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CP"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CP Antibody - middle region (ARP79530_P050)
Your Rating