CELF3 Antibody - middle region (ARP77088_P050)

• Product Number: ARP77088_P050
• Name: CELF3 Antibody - middle region (ARP77088_P050)
• Protein Size (# AA): 465 amino acids
• Molecular Weight: 51 kDa
• NCBI Gene Id: 11189
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: CUGBP, Elav-like family member 3
• Alias Symbols: CAGH4, ERDA4, ETR-1, TNRC4, BRUNOL1
• Peptide Sequence: Synthetic peptide located within the following region: PTGQPAPDALYPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Multiple alternatively spliced transcript variants encoding different isoforms have been identified in this gene.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CELF3 (ARP77088_P050) antibody is Catalog # AAP77088
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CELF3
• Uniprot ID: Q5SZQ8
• Protein Name: CUGBP Elav-like family member 3
• Protein Accession #: NP_001166120.1
• Purification: Affinity purified
• Nucleotide Accession #: NM_001172649.3
• Tested Species Reactivity: Human
• Gene Symbol: CELF3
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human Liver Tumor
  
  Host: Rabbit
  Target Name: CELF3
  Sample Tissue: Liver Tumor lysates
  Antibody Dilution: 1ug/ml