Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP77088_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

CELF3 Antibody - middle region (ARP77088_P050)

Catalog#: ARP77088_P050
Domestic: within 24 hours delivery International: 3-5 business days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CELF3
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: PTGQPAPDALYPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CELF3 (ARP77088_P050) antibody is Catalog # AAP77088
Datasheets/Manuals Printable datasheet for anti-CELF3 (ARP77088_P050) antibody
Gene Symbol CELF3
Official Gene Full Name CUGBP, Elav-like family member 3
Alias Symbols CAGH4, ERDA4, ETR-1, TNRC4, BRUNOL1,
NCBI Gene Id 11189
Protein Name CUGBP Elav-like family member 3
Description of Target Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Multiple alternatively spliced transcript variants encoding different isoforms have been identified in this gene.
Swissprot Id Q5SZQ8
Protein Accession # NP_001166120.1
Nucleotide Accession # NM_001172649.3
Protein Size (# AA) 465
Molecular Weight 51 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CELF3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CELF3.
Write Your Own Review
You're reviewing:CELF3 Antibody - middle region (ARP77088_P050)
Your Rating