Search Antibody, Protein, and ELISA Kit Solutions

CELF3 Antibody - middle region (ARP77088_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CELF3
Purification:
Affinity purified
Peptide Sequence:
Synthetic peptide located within the following region: PTGQPAPDALYPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSL
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CELF3 (ARP77088_P050) antibody is Catalog # AAP77088
Datasheets/Manuals:
Printable datasheet for anti-CELF3 (ARP77088_P050) antibody
Gene Symbol:
CELF3
Official Gene Full Name:
CUGBP, Elav-like family member 3
Alias Symbols:
CAGH4, ERDA4, ETR-1, TNRC4, BRUNOL1,
NCBI Gene Id:
11189
Protein Name:
CUGBP Elav-like family member 3
Description of Target:
Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Multiple alternatively spliced transcript variants encoding different isoforms have been identified in this gene.
Swissprot Id:
Q5SZQ8
Protein Accession #:
NP_001166120.1
Nucleotide Accession #:
NM_001172649.3
Protein Size (# AA):
465
Molecular Weight:
51 kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CELF3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CELF3.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...