| Product Number |
ARP76073_P050-FITC |
| Product Page |
www.avivasysbio.com/cyp11b1-antibody-n-terminal-region-fitc-arp76073-p050-fitc.html |
| Name |
CYP11B1 Antibody - N-terminal region : FITC (ARP76073_P050-FITC) |
| Protein Size (# AA) |
437 amino acids |
| Molecular Weight |
48kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
1584 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
cytochrome P450 family 11 subfamily B member 1 |
| Alias Symbols |
FHI, CPN1, CYP11B, P450C11 |
| Peptide Sequence |
Synthetic peptide located within the following region: RLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
N/A |
| Description of Target |
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and is involved in the conversion of progesterone to cortisol in the adrenal cortex. Mutations in this gene cause congenital adrenal hyperplasia due to 11-beta-hydroxylase deficiency. Transcript variants encoding different isoforms have been noted for this gene. |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-CYP11B1 (ARP76073_P050-FITC) antibody |
| Blocking Peptide |
For anti-CYP11B1 (ARP76073_P050-FITC) antibody is Catalog # AAP76073 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human C11B1 |
| Uniprot ID |
P15538-2 |
| Protein Name |
cytochrome P450 11B1, mitochondrial |
| Protein Accession # |
NP_001021384 |
| Purification |
Affinity purified |
| Gene Symbol |
CYP11B1 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | |
|
