Search Antibody, Protein, and ELISA Kit Solutions

CYP11B1 Antibody - N-terminal region : FITC (ARP76073_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP76073_P050 Unconjugated

ARP76073_P050-HRP Conjugated

ARP76073_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
CYP11B1
Official Gene Full Name:
cytochrome P450 family 11 subfamily B member 1
NCBI Gene Id:
1584
Protein Name:
cytochrome P450 11B1, mitochondrial
Swissprot Id:
P15538-2
Protein Accession #:
NP_001021384
Alias Symbols:
FHI, CPN1, CYP11B, P450C11
Description of Target:
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and is involved in the conversion of progesterone to cortisol in the adrenal cortex. Mutations in this gene cause congenital adrenal hyperplasia due to 11-beta-hydroxylase deficiency. Transcript variants encoding different isoforms have been noted for this gene.
Protein Size (# AA):
437
Molecular Weight:
48kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CYP11B1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CYP11B1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human C11B1
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: RLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Blocking Peptide:
For anti-CYP11B1 (ARP76073_P050-FITC) antibody is Catalog # AAP76073
Datasheets/Manuals:
Printable datasheet for anti-CYP11B1 (ARP76073_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...