| Product Number |
ARP76069_P050-FITC |
| Product Page |
www.avivasysbio.com/cyp2f1-antibody-n-terminal-region-fitc-arp76069-p050-fitc.html |
| Name |
CYP2F1 Antibody - N-terminal region : FITC (ARP76069_P050-FITC) |
| Protein Size (# AA) |
491 amino acids |
| Molecular Weight |
54kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
1572 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
cytochrome P450 family 2 subfamily F member 1 |
| Alias Symbols |
C2F1, CYP2F, CYPIIF1 |
| Peptide Sequence |
Synthetic peptide located within the following region: ILLLLLALVCLLLTLSSRDKGKLPPGPRPLSILGNLLLLCSQDMLTSLTK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
N/A |
| Description of Target |
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to dehydrogenate 3-methylindole, an endogenous toxin derived from the fermentation of tryptophan, as well as xenobiotic substrates such as naphthalene and ethoxycoumarin. This gene is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q. |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-CYP2F1 (ARP76069_P050-FITC) antibody |
| Blocking Peptide |
For anti-CYP2F1 (ARP76069_P050-FITC) antibody is Catalog # AAP76069 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CP2F1 |
| Uniprot ID |
P24903 |
| Protein Name |
cytochrome P450 2F1 |
| Protein Accession # |
NP_000765 |
| Purification |
Affinity purified |
| Gene Symbol |
CYP2F1 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | |
|
