SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP76069_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP76069_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

CYP2F1 Antibody - N-terminal region : FITC (ARP76069_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-CYP2F1 (ARP76069_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human CP2F1
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: ILLLLLALVCLLLTLSSRDKGKLPPGPRPLSILGNLLLLCSQDMLTSLTK
Concentration0.5 mg/ml
Blocking PeptideFor anti-CYP2F1 (ARP76069_P050-FITC) antibody is Catalog # AAP76069
ReferenceN/A
Gene SymbolCYP2F1
Gene Full Namecytochrome P450 family 2 subfamily F member 1
Alias SymbolsC2F1, CYP2F, CYPIIF1
NCBI Gene Id1572
Protein Namecytochrome P450 2F1
Description of TargetThis gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to dehydrogenate 3-methylindole, an endogenous toxin derived from the fermentation of tryptophan, as well as xenobiotic substrates such as naphthalene and ethoxycoumarin. This gene is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q.
Uniprot IDP24903
Protein Accession #NP_000765
Protein Size (# AA)491
Molecular Weight54kDa
  1. What is the species homology for "CYP2F1 Antibody - N-terminal region : FITC (ARP76069_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "CYP2F1 Antibody - N-terminal region : FITC (ARP76069_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CYP2F1 Antibody - N-terminal region : FITC (ARP76069_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CYP2F1 Antibody - N-terminal region : FITC (ARP76069_P050-FITC)"?

    This target may also be called "C2F1, CYP2F, CYPIIF1" in publications.

  5. What is the shipping cost for "CYP2F1 Antibody - N-terminal region : FITC (ARP76069_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CYP2F1 Antibody - N-terminal region : FITC (ARP76069_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CYP2F1 Antibody - N-terminal region : FITC (ARP76069_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "54kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CYP2F1 Antibody - N-terminal region : FITC (ARP76069_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CYP2F1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CYP2F1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CYP2F1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CYP2F1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CYP2F1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CYP2F1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CYP2F1 Antibody - N-terminal region : FITC (ARP76069_P050-FITC)
Your Rating