Search Antibody, Protein, and ELISA Kit Solutions

CYP2F1 Antibody - N-terminal region : FITC (ARP76069_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP76069_P050 Unconjugated

ARP76069_P050-HRP Conjugated

ARP76069_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
CYP2F1
Official Gene Full Name:
cytochrome P450 family 2 subfamily F member 1
NCBI Gene Id:
1572
Protein Name:
cytochrome P450 2F1
Swissprot Id:
P24903
Protein Accession #:
NP_000765
Alias Symbols:
C2F1, CYP2F, CYPIIF1
Description of Target:
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to dehydrogenate 3-methylindole, an endogenous toxin derived from the fermentation of tryptophan, as well as xenobiotic substrates such as naphthalene and ethoxycoumarin. This gene is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q.
Protein Size (# AA):
491
Molecular Weight:
54kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CYP2F1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CYP2F1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CP2F1
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: ILLLLLALVCLLLTLSSRDKGKLPPGPRPLSILGNLLLLCSQDMLTSLTK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-CYP2F1 (ARP76069_P050-FITC) antibody is Catalog # AAP76069
Datasheets/Manuals:
Printable datasheet for anti-CYP2F1 (ARP76069_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...