PDLIM2 Antibody - C-terminal region (ARP75738_P050)

• Product Number: ARP75738_P050
• Name: PDLIM2 Antibody - C-terminal region (ARP75738_P050)
• Protein Size (# AA): 278 amino acids
• Molecular Weight: 30kDa
• NCBI Gene Id: 64236
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: PDZ and LIM domain 2
• Alias Symbols: SLIM, MYSTIQUE
• Peptide Sequence: Synthetic peptide located within the following region: VLVLPPSPGPRSSRPSMDSEGGSLLLDEDSEVFKMLQENREGRAAPRQSS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: N/A
• Description of Target: This gene encodes a member of the ALP subfamily of PDZ-LIM domain proteins. The encoded protein suppresses anchorage-dependent growth and promotes cell migration and adhesion through interactions with the actin cytoskeleton via the PDZ domain. The encoded protein is also a putative tumor suppressor protein, and decreased expression of this gene is associated with several malignancies including breast cancer and adult T-cell leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Protein Interactions: ACD; POT1; UBC; RELA;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PDLIM2 (ARP75738_P050) antibody is Catalog # AAP75738
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PDLI2
• Uniprot ID: Q96JY6-4
• Protein Name: PDZ and LIM domain protein 2
• Protein Accession #: NP_932159
• Purification: Affinity purified
• Tested Species Reactivity: Human
• Gene Symbol: PDLIM2
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human Fetal Liver
  
  Host: Rabbit
  Target Name: PDLI2
  Sample Type: Fetal Liver lysates
  Antibody Dilution: 1.0ug/ml