SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP75738_P050
Price: $0.00
SKU
ARP75738_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

PDLIM2 Antibody - C-terminal region (ARP75738_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-PDLIM2 (ARP75738_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human PDLI2
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: VLVLPPSPGPRSSRPSMDSEGGSLLLDEDSEVFKMLQENREGRAAPRQSS
Concentration0.5 mg/ml
Blocking PeptideFor anti-PDLIM2 (ARP75738_P050) antibody is Catalog # AAP75738
ReferenceN/A
Gene SymbolPDLIM2
Gene Full NamePDZ and LIM domain 2
Alias SymbolsSLIM, MYSTIQUE
NCBI Gene Id64236
Protein NamePDZ and LIM domain protein 2
Description of TargetThis gene encodes a member of the ALP subfamily of PDZ-LIM domain proteins. The encoded protein suppresses anchorage-dependent growth and promotes cell migration and adhesion through interactions with the actin cytoskeleton via the PDZ domain. The encoded protein is also a putative tumor suppressor protein, and decreased expression of this gene is associated with several malignancies including breast cancer and adult T-cell leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Uniprot IDQ96JY6-4
Protein Accession #NP_932159
Protein Size (# AA)278
Molecular Weight30kDa
Protein InteractionsACD; POT1; UBC; RELA;
  1. What is the species homology for "PDLIM2 Antibody - C-terminal region (ARP75738_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "PDLIM2 Antibody - C-terminal region (ARP75738_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PDLIM2 Antibody - C-terminal region (ARP75738_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PDLIM2 Antibody - C-terminal region (ARP75738_P050)"?

    This target may also be called "SLIM, MYSTIQUE" in publications.

  5. What is the shipping cost for "PDLIM2 Antibody - C-terminal region (ARP75738_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PDLIM2 Antibody - C-terminal region (ARP75738_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PDLIM2 Antibody - C-terminal region (ARP75738_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "30kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PDLIM2 Antibody - C-terminal region (ARP75738_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PDLIM2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PDLIM2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PDLIM2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PDLIM2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PDLIM2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PDLIM2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PDLIM2 Antibody - C-terminal region (ARP75738_P050)
Your Rating
We found other products you might like!