Search Antibody, Protein, and ELISA Kit Solutions

PDLIM2 Antibody - C-terminal region (ARP75738_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75738_P050-FITC Conjugated

ARP75738_P050-HRP Conjugated

ARP75738_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
PDLIM2
Official Gene Full Name:
PDZ and LIM domain 2
NCBI Gene Id:
64236
Protein Name:
PDZ and LIM domain protein 2
Swissprot Id:
Q96JY6-4
Protein Accession #:
NP_932159
Alias Symbols:
SLIM, MYSTIQUE
Description of Target:
This gene encodes a member of the ALP subfamily of PDZ-LIM domain proteins. The encoded protein suppresses anchorage-dependent growth and promotes cell migration and adhesion through interactions with the actin cytoskeleton via the PDZ domain. The encoded protein is also a putative tumor suppressor protein, and decreased expression of this gene is associated with several malignancies including breast cancer and adult T-cell leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Protein Size (# AA):
278
Molecular Weight:
30kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PDLIM2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PDLIM2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PDLI2
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: VLVLPPSPGPRSSRPSMDSEGGSLLLDEDSEVFKMLQENREGRAAPRQSS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ACD; POT1; UBC; RELA;
Blocking Peptide:
For anti-PDLIM2 (ARP75738_P050) antibody is Catalog # AAP75738
Datasheets/Manuals:
Printable datasheet for anti-PDLIM2 (ARP75738_P050) antibody
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...