SUN2 Antibody - N-terminal region : FITC (ARP75499_P050-FITC)

Data Sheet
 
Product Number ARP75499_P050-FITC
Product Page www.avivasysbio.com/sun2-antibody-n-terminal-region-fitc-arp75499-p050-fitc.html
Name SUN2 Antibody - N-terminal region : FITC (ARP75499_P050-FITC)
Protein Size (# AA) 717 amino acids
Molecular Weight 78kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 25777
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols UNC84B
Peptide Sequence Synthetic peptide located within the following region: RSQRLTRYSQGDDDGSSSSGGSSVAGSQSTLFKDSPLRTLKRKSSNMKRL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target SUN1 (MIM 607723) and SUN2 are inner nuclear membrane (INM) proteins that play a major role in nuclear-cytoplasmic connection by formation of a 'bridge' across the nuclear envelope, known as the LINC complex, via interaction with the conserved luminal KASH domain of nesprins (e.g., SYNE1; MIM 608441) located in the outer nuclear membrane (ONM). The LINC complex provides a direct connection between the nuclear lamina and the cytoskeleton, which contributes to nuclear positioning and cellular rigidity.
Protein Interactions FBXW11; NRM; BTRC; UBC; WHSC1; RPS20; RAB5B; RAB5A; TP53BP1; C9orf3; SYNE1; SYNE2; AGO3; USP20; HGS; RAB5C;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-SUN2 (ARP75499_P050-FITC) antibody
Blocking Peptide For anti-SUN2 (ARP75499_P050-FITC) antibody is Catalog # AAP75499
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human SUN2
Uniprot ID Q9UH99
Protein Accession # XP_005261558
Purification Affinity purified
Gene Symbol SUN2
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com