Search Antibody, Protein, and ELISA Kit Solutions

SUN2 Antibody - N-terminal region : FITC (ARP75499_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75499_P050 Unconjugated

ARP75499_P050-HRP Conjugated

ARP75499_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Protein Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-136427 from Santa Cruz Biotechnology.
Description of Target:
SUN1 (MIM 607723) and SUN2 are inner nuclear membrane (INM) proteins that play a major role in nuclear-cytoplasmic connection by formation of a 'bridge' across the nuclear envelope, known as the LINC complex, via interaction with the conserved luminal KASH domain of nesprins (e.g., SYNE1; MIM 608441) located in the outer nuclear membrane (ONM). The LINC complex provides a direct connection between the nuclear lamina and the cytoskeleton, which contributes to nuclear positioning and cellular rigidity.
Protein Size (# AA):
Molecular Weight:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SUN2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SUN2.
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SUN2
Predicted Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: RSQRLTRYSQGDDDGSSSSGGSSVAGSQSTLFKDSPLRTLKRKSSNMKRL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SUN2 (ARP75499_P050-FITC) antibody is Catalog # AAP75499
Printable datasheet for anti-SUN2 (ARP75499_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...