PRKD3 Antibody - middle region : FITC (ARP75491_P050-FITC)

Data Sheet
 
Product Number ARP75491_P050-FITC
Product Page www.avivasysbio.com/prkd3-antibody-middle-region-fitc-arp75491-p050-fitc.html
Name PRKD3 Antibody - middle region : FITC (ARP75491_P050-FITC)
Protein Size (# AA) 890 amino acids
Molecular Weight 97kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 23683
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name protein kinase D3
Alias Symbols EPK2, PKD3, PRKCN, PKC-NU, nPKC-NU
Peptide Sequence Synthetic peptide located within the following region: GEVTFNGEPSSLGTDTDIPMDIDNNDINSDSSRGLDDTEEPSPPEDKMFF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target This gene belongs to the multigene protein kinase D family of serine/threonine kinases, which bind diacylglycerol and phorbol esters. Members of this family are characterized by an N-terminal regulatory domain comprised of a tandem repeat of cysteine-rich zinc-finger motifs and a pleckstrin domain. The C-terminal region contains the catalytic domain and is distantly related to calcium-regulated kinases. Catalytic activity of this enzyme promotes its nuclear localization. This protein has been implicated in a variety of functions including negative regulation of human airway epithelial barrier formation, growth regulation of breast and prostate cancer cells, and vesicle trafficking.
Protein Interactions SKA2; UBC; DLAT; NUDT3; HDAC5; BCL6; IKBKG; RAE1; GSK3A; KPNB1; KPNA2; VAMP2;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-PRKD3 (ARP75491_P050-FITC) antibody
Blocking Peptide For anti-PRKD3 (ARP75491_P050-FITC) antibody is Catalog # AAP75491
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human KPCD3
Uniprot ID O94806
Protein Name serine/threonine-protein kinase D3
Protein Accession # XP_005264294
Purification Affinity purified
Gene Symbol PRKD3
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com