Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP75491_P050 Unconjugated

ARP75491_P050-HRP Conjugated

ARP75491_P050-Biotin Conjugated

PRKD3 Antibody - middle region : FITC (ARP75491_P050-FITC)

Catalog#: ARP75491_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human KPCD3
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: GEVTFNGEPSSLGTDTDIPMDIDNNDINSDSSRGLDDTEEPSPPEDKMFF
Concentration 0.5 mg/ml
Blocking Peptide For anti-PRKD3 (ARP75491_P050-FITC) antibody is Catalog # AAP75491
Datasheets/Manuals Printable datasheet for anti-PRKD3 (ARP75491_P050-FITC) antibody
Gene Symbol PRKD3
Official Gene Full Name protein kinase D3
Alias Symbols EPK2, PKD3, PRKCN, PKC-NU, nPKC-NU
NCBI Gene Id 23683
Protein Name serine/threonine-protein kinase D3
Description of Target This gene belongs to the multigene protein kinase D family of serine/threonine kinases, which bind diacylglycerol and phorbol esters. Members of this family are characterized by an N-terminal regulatory domain comprised of a tandem repeat of cysteine-rich zinc-finger motifs and a pleckstrin domain. The C-terminal region contains the catalytic domain and is distantly related to calcium-regulated kinases. Catalytic activity of this enzyme promotes its nuclear localization. This protein has been implicated in a variety of functions including negative regulation of human airway epithelial barrier formation, growth regulation of breast and prostate cancer cells, and vesicle trafficking.
Swissprot Id O94806
Protein Accession # XP_005264294
Protein Size (# AA) 890
Molecular Weight 97kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express PRKD3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express PRKD3.
Protein Interactions SKA2; UBC; DLAT; NUDT3; HDAC5; BCL6; IKBKG; RAE1; GSK3A; KPNB1; KPNA2; VAMP2;
  1. What is the species homology for "PRKD3 Antibody - middle region : FITC (ARP75491_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "PRKD3 Antibody - middle region : FITC (ARP75491_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PRKD3 Antibody - middle region : FITC (ARP75491_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact

  4. What are other names for "PRKD3 Antibody - middle region : FITC (ARP75491_P050-FITC)"?

    This target may also be called "EPK2, PKD3, PRKCN, PKC-NU, nPKC-NU" in publications.

  5. What is the shipping cost for "PRKD3 Antibody - middle region : FITC (ARP75491_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PRKD3 Antibody - middle region : FITC (ARP75491_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PRKD3 Antibody - middle region : FITC (ARP75491_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "97kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PRKD3 Antibody - middle region : FITC (ARP75491_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "PRKD3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PRKD3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PRKD3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PRKD3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PRKD3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PRKD3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PRKD3 Antibody - middle region : FITC (ARP75491_P050-FITC)
Your Rating
We found other products you might like!