| Product Number |
ARP75022_P050 |
| Product Page |
www.avivasysbio.com/phka1-antibody-c-terminal-arp75022-p050.html |
| Name |
PHKA1 Antibody - C-terminal (ARP75022_P050) |
| Protein Size (# AA) |
1151 amino acids |
| Molecular Weight |
126 kDa |
| NCBI Gene Id |
5255 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
phosphorylase kinase, alpha 1 (muscle) |
| Alias Symbols |
PHKA |
| Peptide Sequence |
Synthetic peptide located within the following region: KQSPGTSMTPSSGSFPSAYDQQSSKDSRQGQWQRRRRLDGALNRVPVGFY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Phosphorylase kinase is a polymer of 16 subunits, four each of alpha, beta, gamma and delta. The alpha subunit includes the skeletal muscle and hepatic isoforms, and the skeletal muscle isoform is encoded by this gene. The beta subunit is the same in both the muscle and hepatic isoforms, and encoded by one gene. The gamma subunit also includes the skeletal muscle and hepatic isoforms, which are encoded by two different genes. The delta subunit is a calmodulin and can be encoded by three different genes. The gamma subunits contain the active site of the enzyme, whereas the alpha and beta subunits have regulatory functions controlled by phosphorylation. The delta subunit mediates the dependence of the enzyme on calcium concentration. Mutations in this gene cause glycogen storage disease type 9D, also known as X-linked muscle glycogenosis. Alternatively spliced transcript variants encoding different isoforms have been identified in this gene. A pseudogene has been found on chromosome 1. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PHKA1 (ARP75022_P050) antibody |
| Blocking Peptide |
For Anti-PHKA1 antibody is Catalog # AAP75022 |
| Immunogen |
The immunogen for Anti-PHKA1 antibody is: synthetic peptide directed towards the C-terminal of Human KPB1 |
| Uniprot ID |
P46020-3 |
| Purification |
Affinity purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PHKA1 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human 293T Whole Cell
 | Host: Rabbit
Target Name: KPB1
Sample Type: 293T Whole Cell
Antibody Dilution: 1.0ug/ml |
|
|
