Search Antibody, Protein, and ELISA Kit Solutions

PHKA1 Antibody - C-terminal (ARP75022_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75022_P050-FITC Conjugated

ARP75022_P050-HRP Conjugated

ARP75022_P050-Biotin Conjugated

Gene Symbol:
PHKA1
Official Gene Full Name:
phosphorylase kinase, alpha 1 (muscle)
NCBI Gene Id:
5255
Swissprot Id:
P46020-3
Alias Symbols:
PHKA
Replacement Item:
This antibody may replace item sc-152223 from Santa Cruz Biotechnology.
Description of Target:
Phosphorylase kinase is a polymer of 16 subunits, four each of alpha, beta, gamma and delta. The alpha subunit includes the skeletal muscle and hepatic isoforms, and the skeletal muscle isoform is encoded by this gene. The beta subunit is the same in both the muscle and hepatic isoforms, and encoded by one gene. The gamma subunit also includes the skeletal muscle and hepatic isoforms, which are encoded by two different genes. The delta subunit is a calmodulin and can be encoded by three different genes. The gamma subunits contain the active site of the enzyme, whereas the alpha and beta subunits have regulatory functions controlled by phosphorylation. The delta subunit mediates the dependence of the enzyme on calcium concentration. Mutations in this gene cause glycogen storage disease type 9D, also known as X-linked muscle glycogenosis. Alternatively spliced transcript variants encoding different isoforms have been identified in this gene. A pseudogene has been found on chromosome 1.
Protein Size (# AA):
1151
Molecular Weight:
126 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PHKA1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PHKA1.
Immunogen:
The immunogen for Anti-PHKA1 antibody is: synthetic peptide directed towards the C-terminal of Human KPB1
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: KQSPGTSMTPSSGSFPSAYDQQSSKDSRQGQWQRRRRLDGALNRVPVGFY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Blocking Peptide:
For Anti-PHKA1 antibody is Catalog # AAP75022
Datasheets/Manuals:
Printable datasheet for anti-PHKA1 (ARP75022_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...