TBX1 Antibody - middle region : FITC (ARP74278_P050-FITC)

• Product Number: ARP74278_P050-FITC
• Name: TBX1 Antibody - middle region : FITC (ARP74278_P050-FITC)
• Protein Size (# AA): 495 amino acids
• Molecular Weight: 54kDa
• Conjugation: FITC: Fluorescein Isothiocyanate
• NCBI Gene Id: 6899
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Alias Symbols: DGS, TGA, VCF, CAFS, CTHM, DGCR, DORV, VCFS, TBX1C, CATCH22
• Peptide Sequence: Synthetic peptide located within the following region: FAKGFRDCDPEDWPRNHRPGALPLMSAFARSRNPVASPTQPSGTEKDAAE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Description of Target: This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene product shares 98% amino acid sequence identity with the mouse ortholog. DiGeorge syndrome (DGS)/velocardiofacial syndrome (VCFS), a common congenital disorder characterized by neural-crest-related developmental defects, has been associated with deletions of chromosome 22q11.2, where this gene has been mapped. Studies using mouse models of DiGeorge syndrome suggest a major role for this gene in the molecular etiology of DGS/VCFS. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene.
• Protein Interactions: TERF2; TERF1;
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-TBX1 (ARP74278_P050-FITC) antibody is Catalog # AAP74278
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TBX1
• Uniprot ID: O43435-3
• Protein Accession #: XP_006724375
• Purification: Affinity Purified
• Gene Symbol: TBX1
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: