Search Antibody, Protein, and ELISA Kit Solutions

TBX1 Antibody - middle region : FITC (ARP74278_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74278_P050 Unconjugated

ARP74278_P050-HRP Conjugated

ARP74278_P050-Biotin Conjugated

Gene Symbol:
TBX1
NCBI Gene Id:
6899
Swissprot Id:
O43435-3
Protein Accession #:
XP_006724375
Alias Symbols:
TBX1,
Replacement Item:
This antibody may replace item sc-17874 from Santa Cruz Biotechnology.
Description of Target:
This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene product shares 98% amino acid sequence identity with the mouse ortholog. DiGeorge syndrome (DGS)/velocardiofacial syndrome (VCFS), a common congenital disorder characterized by neural-crest-related developmental defects, has been associated with deletions of chromosome 22q11.2, where this gene has been mapped. Studies using mouse models of DiGeorge syndrome suggest a major role for this gene in the molecular etiology of DGS/VCFS. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Protein Size (# AA):
495
Molecular Weight:
54kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TBX1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TBX1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human TBX1
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: FAKGFRDCDPEDWPRNHRPGALPLMSAFARSRNPVASPTQPSGTEKDAAE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
TERF2; TERF1;
Blocking Peptide:
For anti-TBX1 (ARP74278_P050-FITC) antibody is Catalog # AAP74278
Datasheets/Manuals:
Printable datasheet for anti-TBX1 (ARP74278_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...