Size:100 ul
$289.00
In Stock
SKU
ARP74278_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP74278_P050 Unconjugated

ARP74278_P050-HRP Conjugated

ARP74278_P050-Biotin Conjugated

TBX1 Antibody - middle region : FITC (ARP74278_P050-FITC)

Catalog#: ARP74278_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC (FAM): Excitation 495 nm/ Emission 520 nm
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement ItemThis antibody may replace item sc-17874 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human TBX1
PurificationAffinity Purified
Peptide SequenceSynthetic peptide located within the following region: FAKGFRDCDPEDWPRNHRPGALPLMSAFARSRNPVASPTQPSGTEKDAAE
Concentration0.5 mg/ml
Blocking PeptideFor anti-TBX1 (ARP74278_P050-FITC) antibody is Catalog # AAP74278
Datasheets/ManualsPrintable datasheet for anti-TBX1 (ARP74278_P050-FITC) antibody
Gene SymbolTBX1
Alias SymbolsTBX1,
NCBI Gene Id6899
Description of TargetThis gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene product shares 98% amino acid sequence identity with the mouse ortholog. DiGeorge syndrome (DGS)/velocardiofacial syndrome (VCFS), a common congenital disorder characterized by neural-crest-related developmental defects, has been associated with deletions of chromosome 22q11.2, where this gene has been mapped. Studies using mouse models of DiGeorge syndrome suggest a major role for this gene in the molecular etiology of DGS/VCFS. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Swissprot IdO43435-3
Protein Accession #XP_006724375
Protein Size (# AA)495
Molecular Weight54kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express TBX1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express TBX1.
Protein InteractionsTERF2; TERF1;
Write Your Own Review
You're reviewing:TBX1 Antibody - middle region : FITC (ARP74278_P050-FITC)
Your Rating
Aviva Tissue Tool
Aviva Live Chat
Aviva Travel Grant
Aviva Tips and Tricks