| Product Number |
ARP74174_P050-FITC |
| Product Page |
www.avivasysbio.com/rasa3-antibody-n-terminal-region-fitc-arp74174-p050-fitc.html |
| Name |
RASA3 Antibody - N-terminal region : FITC (ARP74174_P050-FITC) |
| Protein Size (# AA) |
834 amino acids |
| Molecular Weight |
91kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
22821 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
GAPIII, GAP1IP4BP |
| Peptide Sequence |
Synthetic peptide located within the following region: YEAWYFLQPRDNGSKSLKPDDLGSLRLNVVYTEDHVFSSDYYSPLRDLLL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Description of Target |
The protein encoded by this gene is member of the GAP1 family of GTPase-activating proteins. The gene product stimulates the GTPase activity of normal RAS p21 but not its oncogenic counterpart. Acting as a suppressor of RAS function, the protein enhances the weak intrinsic GTPase activity of RAS proteins resulting in the inactive GDP-bound form of RAS, thereby allowing control of cellular proliferation and differentiation. This family member is an inositol 1,3,4,5-tetrakisphosphate-binding protein, like the closely related RAS p21 protein activator 2. The two family members have distinct pleckstrin-homology domains, with this particular member having a domain consistent with its localization to the plasma membrane. |
| Protein Interactions |
UBC; ARHGAP19; SPTB; APP; FES; RAP1A; GNB2L1; HCK; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-RASA3 (ARP74174_P050-FITC) antibody |
| Blocking Peptide |
For anti-RASA3 (ARP74174_P050-FITC) antibody is Catalog # AAP74174 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human RASA3 |
| Uniprot ID |
Q14644 |
| Protein Accession # |
NP_031394 |
| Purification |
Affinity Purified |
| Gene Symbol |
RASA3 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | |
|
