Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

RASA3 Antibody - N-terminal region : FITC (ARP74174_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74174_P050 Unconjugated

ARP74174_P050-HRP Conjugated

ARP74174_P050-Biotin Conjugated

Gene Symbol:
RASA3
NCBI Gene Id:
22821
Swissprot Id:
Q14644
Protein Accession #:
NP_031394
Alias Symbols:
RASA3,
Replacement Item:
This antibody may replace item sc-115741 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is member of the GAP1 family of GTPase-activating proteins. The gene product stimulates the GTPase activity of normal RAS p21 but not its oncogenic counterpart. Acting as a suppressor of RAS function, the protein enhances the weak intrinsic GTPase activity of RAS proteins resulting in the inactive GDP-bound form of RAS, thereby allowing control of cellular proliferation and differentiation. This family member is an inositol 1,3,4,5-tetrakisphosphate-binding protein, like the closely related RAS p21 protein activator 2. The two family members have distinct pleckstrin-homology domains, with this particular member having a domain consistent with its localization to the plasma membrane.
Protein Size (# AA):
834
Molecular Weight:
91kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RASA3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RASA3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human RASA3
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: YEAWYFLQPRDNGSKSLKPDDLGSLRLNVVYTEDHVFSSDYYSPLRDLLL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
UBC; ARHGAP19; SPTB; APP; FES; RAP1A; GNB2L1; HCK;
Blocking Peptide:
For anti-RASA3 (ARP74174_P050-FITC) antibody is Catalog # AAP74174
Datasheets/Manuals:
Printable datasheet for anti-RASA3 (ARP74174_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...