PDLIM7 Antibody - middle region : FITC (ARP74121_P050-FITC)

Data Sheet
 
Product Number ARP74121_P050-FITC
Product Page www.avivasysbio.com/pdlim7-antibody-middle-region-fitc-arp74121-p050-fitc.html
Name PDLIM7 Antibody - middle region : FITC (ARP74121_P050-FITC)
Protein Size (# AA) 457 amino acids
Molecular Weight 50kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 9260
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name PDZ and LIM domain 7
Alias Symbols LMP1, LMP3
Peptide Sequence Synthetic peptide located within the following region: SSTPQEPWPGPTAPSPTSRPPWAVDPAFAERYAPDKTSTVLTRHSQPATP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference N/A
Description of Target The protein encoded by this gene is representative of a family of proteins composed of conserved PDZ and LIM domains. LIM domains are proposed to function in protein-protein recognition in a variety of contexts including gene transcription and development and in cytoskeletal interaction. The LIM domains of this protein bind to protein kinases, whereas the PDZ domain binds to actin filaments. The gene product is involved in the assembly of an actin filament-associated complex essential for transmission of ret/ptc2 mitogenic signaling. The biological function is likely to be that of an adapter, with the PDZ domain localizing the LIM-binding proteins to actin filaments of both skeletal muscle and nonmuscle tissues. Alternative splicing of this gene results in multiple transcript variants.
Protein Interactions WWP2; IQGAP1; TSG101; PHF1; DGCR6; BAG3; RET; CBLC; COPS5; PARP1; YAP1; HNRNPD; PRKD2; ZMYND11; TRADD; UBC; SH3BP2; MYC; Hoxa1; NDUFA7; PCBP1; UBQLN4; TRAF3; TRAF2; TAB2; TRAF6; NR2C2; SMURF1; TP53; MDM2; Cdk1; PSMF1; SH2B2; C20orf195; AP5B1; ENKD1; TPM2;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-PDLIM7 (ARP74121_P050-FITC) antibody
Blocking Peptide For anti-PDLIM7 (ARP74121_P050-FITC) antibody is Catalog # AAP74121
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human PDLI7
Uniprot ID Q9NR12
Protein Name PDZ and LIM domain protein 7
Purification Affinity purified
Gene Symbol PDLIM7
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com