PDLIM7 Peptide - middle region (AAP74121)

Data Sheet
 
Sku AAP74121
Price 99
Name PDLIM7 Peptide - middle region (AAP74121)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene PDLIM7
Alias symbols LMP1, LMP3
Gene id 9260
Description of target The protein encoded by this gene is representative of a family of proteins composed of conserved PDZ and LIM domains. LIM domains are proposed to function in protein-protein recognition in a variety of contexts including gene transcription and development and in cytoskeletal interaction. The LIM domains of this protein bind to protein kinases, whereas the PDZ domain binds to actin filaments. The gene product is involved in the assembly of an actin filament-associated complex essential for transmission of ret/ptc2 mitogenic signaling. The biological function is likely to be that of an adapter, with the PDZ domain localizing the LIM-binding proteins to actin filaments of both skeletal muscle and nonmuscle tissues. Alternative splicing of this gene results in multiple transcript variants.
Swissprot id Q9NR12
Protein size 457 amino acids
Molecular weight 50kDa
Species reactivity Human
Peptide sequence Synthetic peptide located within the following region: SSTPQEPWPGPTAPSPTSRPPWAVDPAFAERYAPDKTSTVLTRHSQPATP
Partner proteins WWP2; IQGAP1; TSG101; PHF1; DGCR6; BAG3; RET; CBLC; COPS5; PARP1; YAP1; HNRNPD; PRKD2; ZMYND11; TRADD; UBC; SH3BP2; MYC; Hoxa1; NDUFA7; PCBP1; UBQLN4; TRAF3; TRAF2; TAB2; TRAF6; NR2C2; SMURF1; TP53; MDM2; Cdk1; PSMF1; SH2B2; C20orf195; AP5B1; ENKD1; TPM2;
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-PDLI7 Antibody (ARP74121_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com