PALLD Antibody - N-terminal region : FITC (ARP74111_P050-FITC)

• Product Number: ARP74111_P050-FITC
• Name: PALLD Antibody - N-terminal region : FITC (ARP74111_P050-FITC)
• Protein Size (# AA): 1383 amino acids
• Molecular Weight: 152kDa
• Conjugation: FITC: Fluorescein Isothiocyanate
• NCBI Gene Id: 23022
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Alias Symbols: MYN, PNCA1, CGI151, SIH002, CGI-151
• Peptide Sequence: Synthetic peptide located within the following region: HQRKGGPQSQLCDKAANLIEELTSIFKAAKPRNRSPNGESSSPDSGYLSP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Description of Target: This gene encodes a cytoskeletal protein that is required for organizing the actin cytoskeleton. The protein is a component of actin-containing microfilaments, and it is involved in the control of cell shape, adhesion, and contraction. Polymorphisms in this gene are associated with a susceptibility to pancreatic cancer type 1, and also with a risk for myocardial infarction. Alternative splicing results in multiple transcript variants.
• Protein Interactions: UBC; LIG4; SARS; NDUFV1; IGBP1; HSP90AA4P; HSPB1; ACOX1; DSTN; ISG15; SORBS2; ACTN1; ITGB5; EZR; ACTN2;
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-PALLD (ARP74111_P050-FITC) antibody is Catalog # AAP74111
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human PALLD
• Uniprot ID: Q8WX93
• Protein Accession #: XP_005262919
• Purification: Affinity Purified
• Gene Symbol: PALLD
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: