Search Antibody, Protein, and ELISA Kit Solutions

PALLD Antibody - N-terminal region : FITC (ARP74111_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74111_P050 Unconjugated

ARP74111_P050-HRP Conjugated

ARP74111_P050-Biotin Conjugated

Gene Symbol:
PALLD
NCBI Gene Id:
23022
Swissprot Id:
Q8WX93
Protein Accession #:
XP_005262919
Alias Symbols:
PALLD, KIAA0992, CGI-151,
Replacement Item:
This antibody may replace item sc-151999 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a cytoskeletal protein that is required for organizing the actin cytoskeleton. The protein is a component of actin-containing microfilaments, and it is involved in the control of cell shape, adhesion, and contraction. Polymorphisms in this gene are associated with a susceptibility to pancreatic cancer type 1, and also with a risk for myocardial infarction. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
1383
Molecular Weight:
152kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PALLD.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PALLD.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PALLD
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: HQRKGGPQSQLCDKAANLIEELTSIFKAAKPRNRSPNGESSSPDSGYLSP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
UBC; LIG4; SARS; NDUFV1; IGBP1; HSP90AA4P; HSPB1; ACOX1; DSTN; ISG15; SORBS2; ACTN1; ITGB5; EZR; ACTN2;
Blocking Peptide:
For anti-PALLD (ARP74111_P050-FITC) antibody is Catalog # AAP74111
Datasheets/Manuals:
Printable datasheet for anti-PALLD (ARP74111_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...