Product Number |
ARP74061_P050-FITC |
Product Page |
www.avivasysbio.com/melk-antibody-middle-region-fitc-arp74061-p050-fitc.html |
Name |
MELK Antibody - middle region : FITC (ARP74061_P050-FITC) |
Protein Size (# AA) |
457 amino acids |
Molecular Weight |
50kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
9833 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
HPK38 |
Peptide Sequence |
Synthetic peptide located within the following region: MEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSARDGPRRLKLHYNVT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Reference |
N/A |
Description of Target |
MELK is a serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Has a broad substrate specificity; phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622. Acts as an activator of apoptosis by phosphorylating and activating MAP3K5/ASK1. It acts as a regulator of cell cycle, notably by mediating phosphorylation of CDC25B, promoting localization of CDC25B to the centrosome and the spindle poles during mitosis. And it plays a key role in cell proliferation and carcinogenesis. Required for proliferation of embryonic and postnatal multipotent neural progenitors. Phosphorylates and inhibits BCL2L14, possibly leading to affect mammary carcinogenesis by mediating inhibition of the pro-apoptotic function of BCL2L14. Also involved in the inhibition of spliceosome assembly during mitosis by phosphorylating ZNF622, thereby contributing to its redirection to the nucleus. It may also play a role in primitive hematopoiesis. |
Protein Interactions |
UBC; YGR054W; Acaca; CSN1S1; MELK; MBP; LMNB1; BABAM1; ZNF622; SF3B1; EIF2S1; CDC5L; PPP1R8; HIST1H1B; CDC25B; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-MELK (ARP74061_P050-FITC) antibody |
Blocking Peptide |
For anti-MELK (ARP74061_P050-FITC) antibody is Catalog # AAP74061 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human MELK |
Uniprot ID |
Q14680-3 |
Purification |
Affinity purified |
Gene Symbol |
MELK |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | |
|