Search Antibody, Protein, and ELISA Kit Solutions

MELK Antibody - middle region : FITC (ARP74061_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74061_P050 Unconjugated

ARP74061_P050-HRP Conjugated

ARP74061_P050-Biotin Conjugated

Gene Symbol:
MELK
NCBI Gene Id:
9833
Swissprot Id:
Q14680-3
Alias Symbols:
MELK, KIAA0175,
Replacement Item:
This antibody may replace item sc-130816 from Santa Cruz Biotechnology.
Description of Target:
MELK is a serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Has a broad substrate specificity; phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622. Acts as an activator of apoptosis by phosphorylating and activating MAP3K5/ASK1. It acts as a regulator of cell cycle, notably by mediating phosphorylation of CDC25B, promoting localization of CDC25B to the centrosome and the spindle poles during mitosis. And it plays a key role in cell proliferation and carcinogenesis. Required for proliferation of embryonic and postnatal multipotent neural progenitors. Phosphorylates and inhibits BCL2L14, possibly leading to affect mammary carcinogenesis by mediating inhibition of the pro-apoptotic function of BCL2L14. Also involved in the inhibition of spliceosome assembly during mitosis by phosphorylating ZNF622, thereby contributing to its redirection to the nucleus. It may also play a role in primitive hematopoiesis.
Protein Size (# AA):
457
Molecular Weight:
50kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MELK.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MELK.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human MELK
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: MEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSARDGPRRLKLHYNVT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
UBC; YGR054W; Acaca; CSN1S1; MELK; MBP; LMNB1; BABAM1; ZNF622; SF3B1; EIF2S1; CDC5L; PPP1R8; HIST1H1B; CDC25B;
Blocking Peptide:
For anti-MELK (ARP74061_P050-FITC) antibody is Catalog # AAP74061
Datasheets/Manuals:
Printable datasheet for anti-MELK (ARP74061_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...