Size:100 ul
$289.00
In Stock
SKU
ARP74061_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP74061_P050 Unconjugated

ARP74061_P050-HRP Conjugated

ARP74061_P050-Biotin Conjugated

MELK Antibody - middle region : FITC (ARP74061_P050-FITC)

Catalog#: ARP74061_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-130816 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human MELK
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: MEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSARDGPRRLKLHYNVT
Concentration 0.5 mg/ml
Blocking Peptide For anti-MELK (ARP74061_P050-FITC) antibody is Catalog # AAP74061
Datasheets/Manuals Printable datasheet for anti-MELK (ARP74061_P050-FITC) antibody
Target Reference N/A
Gene Symbol MELK
Alias Symbols MELK, KIAA0175,
NCBI Gene Id 9833
Description of Target MELK is a serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Has a broad substrate specificity; phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622. Acts as an activator of apoptosis by phosphorylating and activating MAP3K5/ASK1. It acts as a regulator of cell cycle, notably by mediating phosphorylation of CDC25B, promoting localization of CDC25B to the centrosome and the spindle poles during mitosis. And it plays a key role in cell proliferation and carcinogenesis. Required for proliferation of embryonic and postnatal multipotent neural progenitors. Phosphorylates and inhibits BCL2L14, possibly leading to affect mammary carcinogenesis by mediating inhibition of the pro-apoptotic function of BCL2L14. Also involved in the inhibition of spliceosome assembly during mitosis by phosphorylating ZNF622, thereby contributing to its redirection to the nucleus. It may also play a role in primitive hematopoiesis.
Swissprot Id Q14680-3
Protein Size (# AA) 457
Molecular Weight 50kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MELK.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MELK.
Protein Interactions UBC; YGR054W; Acaca; CSN1S1; MELK; MBP; LMNB1; BABAM1; ZNF622; SF3B1; EIF2S1; CDC5L; PPP1R8; HIST1H1B; CDC25B;
  1. What is the species homology for "MELK Antibody - middle region : FITC (ARP74061_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "MELK Antibody - middle region : FITC (ARP74061_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MELK Antibody - middle region : FITC (ARP74061_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MELK Antibody - middle region : FITC (ARP74061_P050-FITC)"?

    This target may also be called "MELK, KIAA0175, " in publications.

  5. What is the shipping cost for "MELK Antibody - middle region : FITC (ARP74061_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MELK Antibody - middle region : FITC (ARP74061_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MELK Antibody - middle region : FITC (ARP74061_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "50kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MELK Antibody - middle region : FITC (ARP74061_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MELK"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MELK"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MELK"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MELK"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MELK"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MELK"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MELK Antibody - middle region : FITC (ARP74061_P050-FITC)
Your Rating
We found other products you might like!