GAS1 Antibody - C-terminal region : FITC (ARP73867_P050-FITC)

Data Sheet
 
Product Number ARP73867_P050-FITC
Product Page www.avivasysbio.com/gas1-antibody-c-terminal-region-fitc-arp73867-p050-fitc.html
Name GAS1 Antibody - C-terminal region : FITC (ARP73867_P050-FITC)
Protein Size (# AA) 345 amino acids
Molecular Weight 37kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 2619
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols GAS1,
Peptide Sequence Synthetic peptide located within the following region: PICESVKENMARLCFGAELGNGPGSSGSDGGLDDYYDEDYDDEQRTGGAG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target Growth arrest-specific 1 plays a role in growth suppression. GAS1 blocks entry to S phase and prevents cycling of normal and transformed cells. Gas1 is a putative tumor suppressor gene.
Protein Interactions ELAVL1; UBC; BIRC3; SHH; DLK1;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-GAS1 (ARP73867_P050-FITC) antibody
Blocking Peptide For anti-GAS1 (ARP73867_P050-FITC) antibody is Catalog # AAP73867
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human GAS1
Uniprot ID P54826
Protein Accession # NP_002039
Purification Affinity Purified
Gene Symbol GAS1
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com