Search Antibody, Protein, and ELISA Kit Solutions

GAS1 Antibody - C-terminal region : FITC (ARP73867_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73867_P050 Unconjugated

ARP73867_P050-HRP Conjugated

ARP73867_P050-Biotin Conjugated

Gene Symbol:
GAS1
NCBI Gene Id:
2619
Swissprot Id:
P54826
Protein Accession #:
NP_002039
Alias Symbols:
GAS1,
Replacement Item:
This antibody may replace item sc-33175 from Santa Cruz Biotechnology.
Description of Target:
Growth arrest-specific 1 plays a role in growth suppression. GAS1 blocks entry to S phase and prevents cycling of normal and transformed cells. Gas1 is a putative tumor suppressor gene.
Protein Size (# AA):
345
Molecular Weight:
37kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GAS1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GAS1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GAS1
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: PICESVKENMARLCFGAELGNGPGSSGSDGGLDDYYDEDYDDEQRTGGAG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
ELAVL1; UBC; BIRC3; SHH; DLK1;
Blocking Peptide:
For anti-GAS1 (ARP73867_P050-FITC) antibody is Catalog # AAP73867
Datasheets/Manuals:
Printable datasheet for anti-GAS1 (ARP73867_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...