TESC Antibody - N-terminal region (ARP72984_P050)

• Product Number: ARP72984_P050
• Name: TESC Antibody - N-terminal region (ARP72984_P050)
• Protein Size (# AA): 214 amino acids
• Molecular Weight: 23kDa
• NCBI Gene Id: 54997
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Alias Symbols: TSC, CHP3
• Peptide Sequence: Synthetic peptide located within the following region: LELNPIRSKIVRAFFDNRNLRKGPSGLADEINFEDFLTIMSYFRPIDTTM
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: TESC functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na(+)/H(+) exchange activity. It promotes the maturation, transport, cell surface stability and exchange activity of SLC9A1/NHE1 at the plasma membrane. It promotes the induction of hematopoietic stem cell differentiation toward megakaryocytic lineage. It is essential for the coupling of ERK cascade activation with the expression of ETS family genes in megakaryocytic differentiation. It is also involved in granulocytic differentiation in a ERK-dependent manner. It inhibits the phosphatase activity of calcineurin.
• Protein Interactions: WBP11; UBC; CCDC91; HMG20A; TESC; RAI1; DYNLT3; SLC9A1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TESC (ARP72984_P050) antibody is Catalog # AAP72984
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TESC
• Uniprot ID: Q96BS2
• Protein Accession #: NP_060369
• Purification: Affinity Purified
• Tested Species Reactivity: Human
• Gene Symbol: TESC
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human HT1080
  
  Host: Rabbit
  Target Name: TESC
  Sample Type: HT1080 Whole Cell lysates
  Antibody Dilution: 1.0ug/ml