Search Antibody, Protein, and ELISA Kit Solutions

TESC Antibody - N-terminal region (ARP72984_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72984_P050-FITC Conjugated

ARP72984_P050-HRP Conjugated

ARP72984_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Protein Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-109444 from Santa Cruz Biotechnology.
Description of Target:
TESC functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na(+)/H(+) exchange activity. It promotes the maturation, transport, cell surface stability and exchange activity of SLC9A1/NHE1 at the plasma membrane. It promotes the induction of hematopoietic stem cell differentiation toward megakaryocytic lineage. It is essential for the coupling of ERK cascade activation with the expression of ETS family genes in megakaryocytic differentiation. It is also involved in granulocytic differentiation in a ERK-dependent manner. It inhibits the phosphatase activity of calcineurin.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TESC.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TESC.
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TESC
Peptide Sequence:
Synthetic peptide located within the following region: LELNPIRSKIVRAFFDNRNLRKGPSGLADEINFEDFLTIMSYFRPIDTTM
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-TESC (ARP72984_P050) antibody is Catalog # AAP72984
Printable datasheet for anti-TESC (ARP72984_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...