| Product Number |
ARP68303_P050 |
| Product Page |
www.avivasysbio.com/fahd1-antibody-middle-region-arp68303-p050.html |
| Name |
FAHD1 Antibody - middle region (ARP68303_P050) |
| Protein Size (# AA) |
248 amino acids |
| Molecular Weight |
27kDa |
| NCBI Gene Id |
81889 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
YISKL, C16orf36 |
| Peptide Sequence |
Synthetic peptide located within the following region: EAAAMDYVGGYALCLDMTARDVQDECKKKGLPWTLAKSFTASCPVSAFVP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
UBC; EXOSC4; PPAP2A; PAXIP1; MME; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-FAHD1 (ARP68303_P050) antibody |
| Blocking Peptide |
For anti-FAHD1 (ARP68303_P050) antibody is Catalog # AAP68303 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human FAHD1 |
| Uniprot ID |
B1AK40 |
| Protein Name |
Acylpyruvase FAHD1, mitochondrial Ensembl ENSP00000372112 |
| Protein Accession # |
NP_001018114 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001018104 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
FAHD1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse, Yeast, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rat: 100%; Yeast: 86%; Zebrafish: 93% |
| Image 1 | Human HeLa
 | Host: Rabbit
Target Name: FAHD1
Sample Type: Hela Whole cell lysates
Antibody Dilution: 1.0ug/ml |
|
|
