Search Antibody, Protein, and ELISA Kit Solutions

FAHD1 Antibody - middle region (ARP68303_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP68303_P050-FITC Conjugated

ARP68303_P050-HRP Conjugated

ARP68303_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Protein Name:
Acylpyruvase FAHD1, mitochondrial Ensembl ENSP00000372112
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
C16orf36, YISKL
Replacement Item:
This antibody may replace item sc-136675 from Santa Cruz Biotechnology.
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FAHD1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FAHD1.
The immunogen is a synthetic peptide directed towards the middle region of Human FAHD1
Predicted Species Reactivity:
Cow, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rat: 100%; Yeast: 86%; Zebrafish: 93%
Peptide Sequence:
Synthetic peptide located within the following region: EAAAMDYVGGYALCLDMTARDVQDECKKKGLPWTLAKSFTASCPVSAFVP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FAHD1 (ARP68303_P050) antibody is Catalog # AAP68303
Printable datasheet for anti-FAHD1 (ARP68303_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...