| Product Number |
ARP68256_P050 |
| Product Page |
www.avivasysbio.com/dcun1d2-antibody-n-terminal-region-arp68256-p050.html |
| Name |
Dcun1d2 Antibody - N-terminal region (ARP68256_P050) |
| Protein Size (# AA) |
197 amino acids |
| Molecular Weight |
21kDa |
| NCBI Gene Id |
102323 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae) |
| Description |
|
| Alias Symbols |
DCNL2, AW495713, mFLJ10704 |
| Peptide Sequence |
Synthetic peptide located within the following region: MHKLKSAQKDKVRQFMACTQASERTAIYCLTQNEWKLDEATDSFFQNPEA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
Map3k1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Dcun1d2 (ARP68256_P050) antibody |
| Blocking Peptide |
For anti-Dcun1d2 (ARP68256_P050) antibody is Catalog # AAP68256 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Dcun1d2 |
| Uniprot ID |
Q8BZJ7 |
| Protein Name |
DCN1-like protein 2 |
| Publications |
A potent small-molecule inhibitor of the DCN1-UBC12 interaction that selectively blocks cullin 3 neddylation. Nat Commun. 8, 1150 (2017). 29074978
Concentration of neddylation-related molecules in paranodal myelin of the peripheral nervous system. Proc. Jpn. Acad., Ser. B, Phys. Biol. Sci. 92, 56-68 (2016). 26860454 |
| Protein Accession # |
NP_001036114 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001042649 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Dcun1d2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Mouse Heart
 | Host: Rabbit
Target Name: Dcun1d2
Sample Type: Mouse Heart lysates
Antibody Dilution: 1.0ug/ml |
|
