Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP68256_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP68256_P050-FITC Conjugated

ARP68256_P050-HRP Conjugated

ARP68256_P050-Biotin Conjugated

Dcun1d2 Antibody - N-terminal region (ARP68256_P050)

Catalog#: ARP68256_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-105275 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Dcun1d2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide Sequence Synthetic peptide located within the following region: MHKLKSAQKDKVRQFMACTQASERTAIYCLTQNEWKLDEATDSFFQNPEA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-Dcun1d2 (ARP68256_P050) antibody is Catalog # AAP68256
Datasheets/Manuals Printable datasheet for anti-Dcun1d2 (ARP68256_P050) antibody
Publications

Kajigaya, H; Ishibashi, T; Hayashi, A; Yamaguchi, Y; Baba, H; Concentration of neddylation-related molecules in paranodal myelin of the peripheral nervous system. 92, 56-68 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26860454

Gene Symbol Dcun1d2
Official Gene Full Name DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae)
Alias Symbols Dcun1d2
NCBI Gene Id 102323
Protein Name DCN1-like protein 2
Description of Target The function of this protein remains unknown.
Swissprot Id Q8BZJ7
Protein Accession # NP_001036114
Nucleotide Accession # NM_001042649
Protein Size (# AA) 197
Molecular Weight 21kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Dcun1d2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Dcun1d2.
Protein Interactions Map3k1;
Write Your Own Review
You're reviewing:Dcun1d2 Antibody - N-terminal region (ARP68256_P050)
Your Rating