Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP68256_P050-FITC Conjugated

ARP68256_P050-HRP Conjugated

ARP68256_P050-Biotin Conjugated

Dcun1d2 Antibody - N-terminal region (ARP68256_P050)

Catalog#: ARP68256_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-105275 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Dcun1d2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide Sequence Synthetic peptide located within the following region: MHKLKSAQKDKVRQFMACTQASERTAIYCLTQNEWKLDEATDSFFQNPEA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-Dcun1d2 (ARP68256_P050) antibody is Catalog # AAP68256
Datasheets/Manuals Printable datasheet for anti-Dcun1d2 (ARP68256_P050) antibody

Kajigaya, H; Ishibashi, T; Hayashi, A; Yamaguchi, Y; Baba, H; Concentration of neddylation-related molecules in paranodal myelin of the peripheral nervous system. 92, 56-68 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26860454

Gene Symbol Dcun1d2
Official Gene Full Name DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae)
Alias Symbols Dcun1d2
NCBI Gene Id 102323
Protein Name DCN1-like protein 2
Description of Target The function of this protein remains unknown.
Swissprot Id Q8BZJ7
Protein Accession # NP_001036114
Nucleotide Accession # NM_001042649
Protein Size (# AA) 197
Molecular Weight 21kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Dcun1d2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Dcun1d2.
Protein Interactions Map3k1;
  1. What is the species homology for "Dcun1d2 Antibody - N-terminal region (ARP68256_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "Dcun1d2 Antibody - N-terminal region (ARP68256_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Dcun1d2 Antibody - N-terminal region (ARP68256_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "Dcun1d2 Antibody - N-terminal region (ARP68256_P050)"?

    This target may also be called "Dcun1d2" in publications.

  5. What is the shipping cost for "Dcun1d2 Antibody - N-terminal region (ARP68256_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Dcun1d2 Antibody - N-terminal region (ARP68256_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Dcun1d2 Antibody - N-terminal region (ARP68256_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "21kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Dcun1d2 Antibody - N-terminal region (ARP68256_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "DCUN1D2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DCUN1D2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DCUN1D2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DCUN1D2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DCUN1D2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DCUN1D2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Dcun1d2 Antibody - N-terminal region (ARP68256_P050)
Your Rating