Search Antibody, Protein, and ELISA Kit Solutions

Dcun1d2 Antibody - N-terminal region (ARP68256_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP68256_P050-FITC Conjugated

ARP68256_P050-HRP Conjugated

ARP68256_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae)
NCBI Gene Id:
Protein Name:
DCN1-like protein 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-105275 from Santa Cruz Biotechnology.
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Dcun1d2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Dcun1d2.
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Dcun1d2
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide Sequence:
Synthetic peptide located within the following region: MHKLKSAQKDKVRQFMACTQASERTAIYCLTQNEWKLDEATDSFFQNPEA
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-Dcun1d2 (ARP68256_P050) antibody is Catalog # AAP68256
Printable datasheet for anti-Dcun1d2 (ARP68256_P050) antibody

Kajigaya, H; Ishibashi, T; Hayashi, A; Yamaguchi, Y; Baba, H; Concentration of neddylation-related molecules in paranodal myelin of the peripheral nervous system. 92, 56-68 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26860454

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...