Search Antibody, Protein, and ELISA Kit Solutions

Dcun1d2 Antibody - N-terminal region (ARP68256_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP68256_P050-FITC Conjugated

ARP68256_P050-HRP Conjugated

ARP68256_P050-Biotin Conjugated

Gene Symbol:
Dcun1d2
NCBI Gene Id:
102323
Official Gene Full Name:
DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae)
Protein Name:
DCN1-like protein 2
Swissprot Id:
Q8BZJ7
Protein Accession #:
NP_001036114
Nucleotide Accession #:
NM_001042649
Alias Symbols:
Dcun1d2
Replacement Item:
This antibody may replace item sc-105275 from Santa Cruz Biotechnology.
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
197
Molecular Weight:
21kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Dcun1d2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Dcun1d2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Dcun1d2
Tested Species Reactivity:
Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide Sequence:
Synthetic peptide located within the following region: MHKLKSAQKDKVRQFMACTQASERTAIYCLTQNEWKLDEATDSFFQNPEA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Map3k1;
Blocking Peptide:
For anti-Dcun1d2 (ARP68256_P050) antibody is Catalog # AAP68256
Datasheets/Manuals:
Printable datasheet for anti-Dcun1d2 (ARP68256_P050) antibody
Publications:

Kajigaya, H; Ishibashi, T; Hayashi, A; Yamaguchi, Y; Baba, H; Concentration of neddylation-related molecules in paranodal myelin of the peripheral nervous system. 92, 56-68 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26860454

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...