| Product Number |
ARP66514_P050 |
| Product Page |
www.avivasysbio.com/ano5-antibody-arp66514-p050.html |
| Name |
ANO5 Antibody - N-terminal region (ARP66514_P050) |
| Protein Size (# AA) |
913 amino acids |
| Molecular Weight |
107 kDa |
| NCBI Gene Id |
203859 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
anoctamin 5 |
| Alias Symbols |
GDD1, LGMD2L, LGMDR12, TMEM16E |
| Peptide Sequence |
Synthetic peptide located within the following region: PLHDGQYWKPSEPPNPTNERYTLHQNWARFSYFYKEQPLDLIKNYYGEKI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a member of the anoctamin family of transmembrane proteins. The encoded protein is likely a calcium activated chloride channel. Mutations in this gene have been associated with gnathodiaphyseal dysplasia. Alternatively spliced transcript variants have been described. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ANO5 (ARP66514_P050) antibody |
| Blocking Peptide |
For anti-ANO5 (ARP66514_P050) antibody is Catalog # AAP66514 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ANO5 |
| Uniprot ID |
Q75V66 |
| Protein Name |
anoctamin-5 |
| Protein Accession # |
NP_998764 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_213599.2 |
| Gene Symbol |
ANO5 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 92%; Guinea Pig: 83%; Horse: 92%; Human: 100%; Pig: 92%; Rabbit: 93%; Rat: 83% |
| Image 1 | Human 293T Whole Cell
 | Host: Rabbit
Target Name: ANO5
Sample Tissue: Human 293T Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
