| Product Number |
ARP65263_P050-FITC |
| Product Page |
www.avivasysbio.com/pigp-antibody-middle-region-fitc-arp65263-p050-fitc.html |
| Name |
PIGP Antibody - middle region : FITC (ARP65263_P050-FITC) |
| Protein Size (# AA) |
108 amino acids |
| Molecular Weight |
11kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
51227 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
DCRC, DSRC, DEE55, DSCR5, PIG-P, DCRC-S, EIEE55 |
| Peptide Sequence |
Synthetic peptide located within the following region: NMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Description of Target |
This gene encodes an enzyme involved in the first step of glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. The encoded protein is a component of the GPI-N-acetylglucosaminyltransferase complex that catalyzes the transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI). This gene is located in the Down Syndrome critical region on chromosome 21 and is a candidate for the pathogenesis of Down syndrome. Alternatively spliced transcript variants encoding different isoforms have been described. |
| Protein Interactions |
PIGQ; DPM2; PIGA; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-PIGP (ARP65263_P050-FITC) antibody |
| Blocking Peptide |
For anti-PIGP (ARP65263_P050-FITC) antibody is Catalog # AAP65263 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human PIGP |
| Uniprot ID |
P57054-3 |
| Purification |
Affinity Purified |
| Gene Symbol |
PIGP |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | |
|
