Search Antibody, Protein, and ELISA Kit Solutions

PIGP Antibody - middle region : FITC (ARP65263_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP65263_P050 Unconjugated

ARP65263_P050-HRP Conjugated

ARP65263_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
PIGP
NCBI Gene Id:
51227
Swissprot Id:
P57054-3
Alias Symbols:
PIGP, DCRC, DSCR5, DSCRC, NPD010,
Description of Target:
This gene encodes an enzyme involved in the first step of glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. The encoded protein is a component of the GPI-N-acetylglucosaminyltransferase complex that catalyzes the transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI). This gene is located in the Down Syndrome critical region on chromosome 21 and is a candidate for the pathogenesis of Down syndrome. Alternatively spliced transcript variants encoding different isoforms have been described.
Protein Size (# AA):
108
Molecular Weight:
11kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PIGP.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PIGP.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human PIGP
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: NMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
PIGQ; DPM2; PIGA;
Blocking Peptide:
For anti-PIGP (ARP65263_P050-FITC) antibody is Catalog # AAP65263
Datasheets/Manuals:
Printable datasheet for anti-PIGP (ARP65263_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...