| Product Number |
ARP64218_P050 |
| Product Page |
www.avivasysbio.com/epha8-antibody-middle-region-arp64218-p050.html |
| Name |
EPHA8 Antibody - middle region (ARP64218_P050) |
| Protein Size (# AA) |
495 amino acids |
| Molecular Weight |
54 kDa |
| NCBI Gene Id |
2046 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
EPH receptor A8 |
| Alias Symbols |
EEK, EK3, HEK3 |
| Peptide Sequence |
Synthetic peptide located within the following region: YKKCPAMVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEERDTPKMYCSAE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a member of the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. The protein encoded by this gene functions as a receptor for ephrin A2, A3 and A5 and plays a role in short-range contact-mediated axonal guidance during development of the mammalian nervous system. |
| Protein Interactions |
DARS2; G3BP1; PSMC5; AK4; ZNF746; ANKS1A; UBC; CBL; EFNA5; EFNA4; PIK3CG; EFNA1; EPHA8; FYN; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-EPHA8 (ARP64218_P050) antibody |
| Blocking Peptide |
For anti-EPHA8 (ARP64218_P050) antibody is Catalog # AAP64218 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human EPHA8 |
| Uniprot ID |
P29322-2 |
| Protein Name |
Ephrin type-A receptor 8 |
| Protein Accession # |
NP_001006944 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001006943.1 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
EPHA8 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
| Image 1 | Human Testicle Tumor
 | Host: Rabbit
Target Name: EPHA8
Sample Tissue: Human Testicle Tumor lysates
Antibody Dilution: 1ug/ml |
|
|
