Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP64218_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP64218_P050-FITC Conjugated

ARP64218_P050-HRP Conjugated

ARP64218_P050-Biotin Conjugated

EPHA8 Antibody - middle region (ARP64218_P050)

Catalog#: ARP64218_P050
Domestic: within 24 hours delivery | International: 3-5 business days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human EPHA8
PurificationAffinity purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology dataAnti-EPHA8 (ARP64218_P050)
Peptide SequenceSynthetic peptide located within the following region: YKKCPAMVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEERDTPKMYCSAE
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-EPHA8 (ARP64218_P050) antibody is Catalog # AAP64218
Datasheets/ManualsPrintable datasheet for anti-EPHA8 (ARP64218_P050) antibody
Gene SymbolEPHA8
Official Gene Full NameEPH receptor A8
Alias SymbolsEEK, EK3, HEK3
NCBI Gene Id2046
Protein NameEphrin type-A receptor 8
Description of TargetThis gene encodes a member of the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. The protein encoded by this gene functions as a receptor for ephrin A2, A3 and A5 and plays a role in short-range contact-mediated axonal guidance during development of the mammalian nervous system.
Swissprot IdP29322-2
Protein Accession #NP_001006944
Nucleotide Accession #NM_001006943.1
Protein Size (# AA)495
Molecular Weight54 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express EPHA8.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express EPHA8.
Protein InteractionsDARS2; G3BP1; PSMC5; AK4; ZNF746; ANKS1A; UBC; CBL; EFNA5; EFNA4; PIK3CG; EFNA1; EPHA8; FYN;
Write Your Own Review
You're reviewing:EPHA8 Antibody - middle region (ARP64218_P050)
Your Rating
Aviva Travel Grant
Aviva Live Chat
Aviva Blast Tool
Aviva HIS tag Deal