Search Antibody, Protein, and ELISA Kit Solutions

EPHA8 Antibody - middle region (ARP64218_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP64218_P050-FITC Conjugated

ARP64218_P050-HRP Conjugated

ARP64218_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
EPHA8
Official Gene Full Name:
EPH receptor A8
NCBI Gene Id:
2046
Protein Name:
Ephrin type-A receptor 8
Swissprot Id:
P29322-2
Protein Accession #:
NP_001006944
Nucleotide Accession #:
NM_001006943.1
Alias Symbols:
EEK, EK3, HEK3
Description of Target:
This gene encodes a member of the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. The protein encoded by this gene functions as a receptor for ephrin A2, A3 and A5 and plays a role in short-range contact-mediated axonal guidance during development of the mammalian nervous system.
Protein Size (# AA):
495
Molecular Weight:
54 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EPHA8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EPHA8.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human EPHA8
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-EPHA8 (ARP64218_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YKKCPAMVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEERDTPKMYCSAE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
DARS2; G3BP1; PSMC5; AK4; ZNF746; ANKS1A; UBC; CBL; EFNA5; EFNA4; PIK3CG; EFNA1; EPHA8; FYN;
Blocking Peptide:
For anti-EPHA8 (ARP64218_P050) antibody is Catalog # AAP64218
Datasheets/Manuals:
Printable datasheet for anti-EPHA8 (ARP64218_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...