| Product Number |
ARP63969_P050 |
| Product Page |
www.avivasysbio.com/mydgf-antibody-middle-region-arp63969-p050.html |
| Name |
MYDGF Antibody - middle region (ARP63969_P050) |
| Protein Size (# AA) |
173 amino acids |
| Molecular Weight |
19kDa |
| NCBI Gene Id |
56005 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
myeloid derived growth factor |
| Alias Symbols |
IL25, IL27, SF20, IL27w, C19orf10, R33729_1, EUROIMAGE1875335 |
| Peptide Sequence |
Synthetic peptide located within the following region: YASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene was previously thought to support proliferation of lymphoid cells and was considered an interleukin. However, this activity has not been reproducible and the function of this protein is currently unknown. |
| Protein Interactions |
SGTA; MDM2; ATF2; UBQLN4; UBC; BAG6; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MYDGF (ARP63969_P050) antibody |
| Blocking Peptide |
For anti-MYDGF (ARP63969_P050) antibody is Catalog # AAP63969 |
| Uniprot ID |
Q969H8 |
| Protein Name |
myeloid-derived growth factor |
| Protein Accession # |
NP_061980 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_019107 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MYDGF |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 100% |
| Image 1 | Human Placenta
 | Host: Rabbit
Target Name: C19orf10
Antibody Dilution: 1.0ug/ml
Sample Type: Human Placenta |
|
| Image 2 | Human Adult Liver
 | Rabbit Anti-C19orf10 Antibody
Catalog Number: ARP63969_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
Observed Staining: Cytoplasm in hepatocytes, moderate tissue distribution, resemble Golgi structures
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 â 2.0 sec
Protocol located in Reviews and Data. |
|
