Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MYDGF Antibody - middle region (ARP63969_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP63969_P050-FITC Conjugated

ARP63969_P050-HRP Conjugated

ARP63969_P050-Biotin Conjugated

Gene Symbol:
MYDGF
NCBI Gene Id:
56005
Official Gene Full Name:
myeloid derived growth factor
Protein Name:
myeloid-derived growth factor
Swissprot Id:
Q969H8
Protein Accession #:
NP_061980
Nucleotide Accession #:
NM_019107
Alias Symbols:
IL25, IL27, SF20, IL27w, C19orf10, R33729_1, EUROIMAGE1875335
Replacement Item:
This antibody may replace item sc-105567 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene was previously thought to support proliferation of lymphoid cells and was considered an interleukin. However, this activity has not been reproducible and the function of this protein is currently unknown.
Protein Size (# AA):
173
Molecular Weight:
19kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MYDGF.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MYDGF.
Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 100%
Complete computational species homology data:
Anti-C19orf10 (ARP63969_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SGTA; MDM2; ATF2; UBQLN4; UBC; BAG6;
Blocking Peptide:
For anti-MYDGF (ARP63969_P050) antibody is Catalog # AAP63969
Datasheets/Manuals:
Printable datasheet for anti-MYDGF (ARP63969_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...