Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP63969_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP63969_P050-FITC Conjugated

ARP63969_P050-HRP Conjugated

ARP63969_P050-Biotin Conjugated

MYDGF Antibody - middle region (ARP63969_P050)

Catalog#: ARP63969_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Horse, Human, Mouse, Pig, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-105567 from Santa Cruz Biotechnology.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 100%
Complete computational species homology data Anti-C19orf10 (ARP63969_P050)
Peptide Sequence Synthetic peptide located within the following region: YASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MYDGF (ARP63969_P050) antibody is Catalog # AAP63969
Datasheets/Manuals Printable datasheet for anti-MYDGF (ARP63969_P050) antibody
Gene Symbol MYDGF
Official Gene Full Name myeloid derived growth factor
Alias Symbols IL25, IL27, SF20, IL27w, C19orf10, R33729_1, EUROIMAGE1875335
NCBI Gene Id 56005
Protein Name myeloid-derived growth factor
Description of Target The protein encoded by this gene was previously thought to support proliferation of lymphoid cells and was considered an interleukin. However, this activity has not been reproducible and the function of this protein is currently unknown.
Swissprot Id Q969H8
Protein Accession # NP_061980
Nucleotide Accession # NM_019107
Protein Size (# AA) 173
Molecular Weight 19kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MYDGF.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MYDGF.
Protein Interactions SGTA; MDM2; ATF2; UBQLN4; UBC; BAG6;
  1. What is the species homology for "MYDGF Antibody - middle region (ARP63969_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Horse, Human, Mouse, Pig, Rat".

  2. How long will it take to receive "MYDGF Antibody - middle region (ARP63969_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MYDGF Antibody - middle region (ARP63969_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MYDGF Antibody - middle region (ARP63969_P050)"?

    This target may also be called "IL25, IL27, SF20, IL27w, C19orf10, R33729_1, EUROIMAGE1875335" in publications.

  5. What is the shipping cost for "MYDGF Antibody - middle region (ARP63969_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MYDGF Antibody - middle region (ARP63969_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MYDGF Antibody - middle region (ARP63969_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "19kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MYDGF Antibody - middle region (ARP63969_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MYDGF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MYDGF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MYDGF"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MYDGF"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MYDGF"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MYDGF"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MYDGF Antibody - middle region (ARP63969_P050)
Your Rating
We found other products you might like!