| Product Number |
ARP61489_P050 |
| Product Page |
www.avivasysbio.com/ambn-antibody-c-terminal-region-arp61489-p050.html |
| Name |
AMBN Antibody - C-terminal region (ARP61489_P050) |
| Protein Size (# AA) |
447 amino acids |
| Molecular Weight |
49kDa |
| NCBI Gene Id |
258 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Ameloblastin (enamel matrix protein) |
| Alias Symbols |
AI1F |
| Peptide Sequence |
Synthetic peptide located within the following region: RPGFEGMPHNPAMGGDFTLEFDSPVAATKGPENEEGGAQGSPMPEANPDN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Ameloblastin is thought to represent an unique ameloblast-specific gene product that may be important in enamel matrix formation and mineralization. The gene is located on chromosome 4 near other genes associated with mineralized tissues: osteopontin, bone sialoprotein, and bone morphogenetic protein 3. Based on its cytogenetic location, this gene is a candidate gene for one form of the disorder, dentinogenesis imperfecta, and/or the disorder, autosomal dominant amylogenesis imperfecta. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-AMBN (ARP61489_P050) antibody |
| Blocking Peptide |
For anti-AMBN (ARP61489_P050) antibody is Catalog # AAP61489 (Previous Catalog # AAPP47624) |
| Uniprot ID |
Q9NP70 |
| Protein Name |
Ameloblastin |
| Publications |
Isolation and characterization of embryonic ameloblast lineage cells derived from tooth buds of fetal miniature swine. In Vitro Cell. Dev. Biol. Anim. 52, 445-53 (2016). 26698579 |
| Protein Accession # |
NP_057603 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_016519 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
AMBN |
| Predicted Species Reactivity |
Human, Cow, Dog, Guinea Pig, Horse, Sheep |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 86%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Sheep: 79% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-AMBN Antibody
Titration: 1.0 ug/ml
Positive Control: Jurkat Whole Cell |
| | Image 2 | 293T Cell Lysate, A549 Cell Lysate
 | Host: Rabbit
Target: AMBN
Positive control (+): 293T Cell Lysate (2T)
Negative control (-): A549 Cell Lysate (N03)
Antibody concentration: 1ug/ml |
|
|
