Search Antibody, Protein, and ELISA Kit Solutions

AMBN Antibody - C-terminal region (ARP61489_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP61489_P050-FITC Conjugated

ARP61489_P050-HRP Conjugated

ARP61489_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-33102 from Santa Cruz Biotechnology.
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 86%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Sheep: 79%
Complete computational species homology data:
Anti-AMBN (ARP61489_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RPGFEGMPHNPAMGGDFTLEFDSPVAATKGPENEEGGAQGSPMPEANPDN
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-AMBN (ARP61489_P050) antibody is Catalog # AAP61489 (Previous Catalog # AAPP47624)
Printable datasheet for anti-AMBN (ARP61489_P050) antibody

Nakahara, T; Tominaga, N; Toyomura, J; Tachibana, T; Ide, Y; Ishikawa, H; Isolation and characterization of embryonic ameloblast lineage cells derived from tooth buds of fetal miniature swine. 52, 445-53 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Sheep 26698579

Gene Symbol:
Official Gene Full Name:
Ameloblastin (enamel matrix protein)
Alias Symbols:
NCBI Gene Id:
Protein Name:
Description of Target:
Ameloblastin is thought to represent an unique ameloblast-specific gene product that may be important in enamel matrix formation and mineralization. The gene is located on chromosome 4 near other genes associated with mineralized tissues: osteopontin, bone sialoprotein, and bone morphogenetic protein 3. Based on its cytogenetic location, this gene is a candidate gene for one form of the disorder, dentinogenesis imperfecta, and/or the disorder, autosomal dominant amylogenesis imperfecta.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express AMBN.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express AMBN.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...