Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP61489_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP61489_P050-FITC Conjugated

ARP61489_P050-HRP Conjugated

ARP61489_P050-Biotin Conjugated

AMBN Antibody - C-terminal region (ARP61489_P050)

Catalog#: ARP61489_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-33102 from Santa Cruz Biotechnology.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Dog: 86%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Sheep: 79%
Complete computational species homology dataAnti-AMBN (ARP61489_P050)
Peptide SequenceSynthetic peptide located within the following region: RPGFEGMPHNPAMGGDFTLEFDSPVAATKGPENEEGGAQGSPMPEANPDN
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-AMBN (ARP61489_P050) antibody is Catalog # AAP61489 (Previous Catalog # AAPP47624)
Datasheets/ManualsPrintable datasheet for anti-AMBN (ARP61489_P050) antibody
Publications

Nakahara, T; Tominaga, N; Toyomura, J; Tachibana, T; Ide, Y; Ishikawa, H; Isolation and characterization of embryonic ameloblast lineage cells derived from tooth buds of fetal miniature swine. 52, 445-53 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Sheep 26698579

Gene SymbolAMBN
Official Gene Full NameAmeloblastin (enamel matrix protein)
Alias Symbols-
NCBI Gene Id258
Protein NameAmeloblastin
Description of TargetAmeloblastin is thought to represent an unique ameloblast-specific gene product that may be important in enamel matrix formation and mineralization. The gene is located on chromosome 4 near other genes associated with mineralized tissues: osteopontin, bone sialoprotein, and bone morphogenetic protein 3. Based on its cytogenetic location, this gene is a candidate gene for one form of the disorder, dentinogenesis imperfecta, and/or the disorder, autosomal dominant amylogenesis imperfecta.
Swissprot IdQ9NP70
Protein Accession #NP_057603
Nucleotide Accession #NM_016519
Protein Size (# AA)447
Molecular Weight49kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express AMBN.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express AMBN.
  1. What is the species homology for "AMBN Antibody - C-terminal region (ARP61489_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Sheep".

  2. How long will it take to receive "AMBN Antibody - C-terminal region (ARP61489_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "AMBN Antibody - C-terminal region (ARP61489_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "AMBN Antibody - C-terminal region (ARP61489_P050)"?

    This target may also be called "-" in publications.

  5. What is the shipping cost for "AMBN Antibody - C-terminal region (ARP61489_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "AMBN Antibody - C-terminal region (ARP61489_P050)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "AMBN Antibody - C-terminal region (ARP61489_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "49kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "AMBN Antibody - C-terminal region (ARP61489_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "AMBN"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AMBN"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AMBN"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AMBN"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AMBN"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AMBN"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:AMBN Antibody - C-terminal region (ARP61489_P050)
Your Rating
Free Microscope
Aviva Validation Data
Aviva Pathways
Aviva ChIP Antibodies