AMBN Antibody - C-terminal region (ARP61489_P050)

Size:100 ul

Human Jurkat

293T Cell Lysate, A549 Cell Lysate

Basic Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Replacement Item: This antibody may replace item sc-33102 from Santa Cruz Biotechnology.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 86%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Sheep: 79%
• Complete computational species homology data: Anti-AMBN (ARP61489_P050)
• Peptide Sequence: Synthetic peptide located within the following region: RPGFEGMPHNPAMGGDFTLEFDSPVAATKGPENEEGGAQGSPMPEANPDN
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-AMBN (ARP61489_P050) antibody is Catalog # AAP61489 (Previous Catalog # AAPP47624)
• Datasheets/Manuals: Printable datasheet for anti-AMBN (ARP61489_P050) antibody
• Publications:

  Nakahara, T; Tominaga, N; Toyomura, J; Tachibana, T; Ide, Y; Ishikawa, H; Isolation and characterization of embryonic ameloblast lineage cells derived from tooth buds of fetal miniature swine. 52, 445-53 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Sheep 26698579

Target Info

• Gene Symbol: AMBN
• Official Gene Full Name: Ameloblastin (enamel matrix protein)
• Alias Symbols: -
• NCBI Gene Id: 258
• Protein Name: Ameloblastin
• Description of Target: Ameloblastin is thought to represent an unique ameloblast-specific gene product that may be important in enamel matrix formation and mineralization. The gene is located on chromosome 4 near other genes associated with mineralized tissues: osteopontin, bone sialoprotein, and bone morphogenetic protein 3. Based on its cytogenetic location, this gene is a candidate gene for one form of the disorder, dentinogenesis imperfecta, and/or the disorder, autosomal dominant amylogenesis imperfecta.
• Swissprot Id: Q9NP70
• Protein Accession #: NP_057603
• Nucleotide Accession #: NM_016519
• Protein Size (# AA): 447
• Molecular Weight: 49kDa
• Tissue Tool: Find tissues and cell lines supported by DNA array analysis to express AMBN.
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express AMBN.