- Gene Symbol:
- AMBN
- NCBI Gene Id:
- 258
- Official Gene Full Name:
- Ameloblastin (enamel matrix protein)
- Protein Name:
- Ameloblastin
- Swissprot Id:
- Q9NP70
- Protein Accession #:
- NP_057603
- Nucleotide Accession #:
- NM_016519
- Alias Symbols:
- -
- Replacement Item:
- This antibody may replace item sc-33102 from Santa Cruz Biotechnology.
- Description of Target:
- Ameloblastin is thought to represent an unique ameloblast-specific gene product that may be important in enamel matrix formation and mineralization. The gene is located on chromosome 4 near other genes associated with mineralized tissues: osteopontin, bone sialoprotein, and bone morphogenetic protein 3. Based on its cytogenetic location, this gene is a candidate gene for one form of the disorder, dentinogenesis imperfecta, and/or the disorder, autosomal dominant amylogenesis imperfecta.
- Protein Size (# AA):
- 447
- Molecular Weight:
- 49kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express AMBN.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express AMBN.
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 79%; Dog: 86%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Sheep: 79%
- Complete computational species homology data:
- Anti-AMBN (ARP61489_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: RPGFEGMPHNPAMGGDFTLEFDSPVAATKGPENEEGGAQGSPMPEANPDN
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Blocking Peptide:
- For anti-AMBN (ARP61489_P050) antibody is Catalog # AAP61489 (Previous Catalog # AAPP47624)
- Datasheets/Manuals:
- Printable datasheet for anti-AMBN (ARP61489_P050) antibody
- Publications:
Nakahara, T; Tominaga, N; Toyomura, J; Tachibana, T; Ide, Y; Ishikawa, H; Isolation and characterization of embryonic ameloblast lineage cells derived from tooth buds of fetal miniature swine. 52, 445-53 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Sheep 26698579
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
