AMBN Antibody - C-terminal region (ARP61489_P050)

Catalog#: ARP61489_P050

• Size: 100 ul

• Gene Symbol: AMBN
• Official Gene Full Name: Ameloblastin (enamel matrix protein)
• NCBI Gene Id: 258
• Protein Name: Ameloblastin
• Swissprot Id: Q9NP70
• Protein Accession #: NP_057603
• Nucleotide Accession #: NM_016519
• Alias Symbols: -
• Replacement Item: This antibody may replace item sc-33102 from Santa Cruz Biotechnology.
• Description of Target: Ameloblastin is thought to represent an unique ameloblast-specific gene product that may be important in enamel matrix formation and mineralization. The gene is located on chromosome 4 near other genes associated with mineralized tissues: osteopontin, bone sialoprotein, and bone morphogenetic protein 3. Based on its cytogenetic location, this gene is a candidate gene for one form of the disorder, dentinogenesis imperfecta, and/or the disorder, autosomal dominant amylogenesis imperfecta.
• Protein Size (# AA): 447
• Molecular Weight: 49kDa
• Host: Rabbit
• Clonality: Polyclonal
• Purification: Affinity Purified
• Application: WB
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express AMBN.
• Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Sheep
• Tested Species Reactivity: Human
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 86%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Sheep: 79%
• Peptide Sequence: Synthetic peptide located within the following region: RPGFEGMPHNPAMGGDFTLEFDSPVAATKGPENEEGGAQGSPMPEANPDN
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-AMBN (ARP61489_P050) antibody is Catalog # AAP61489 (Previous Catalog # AAPP47624)
• Publications:

  Nakahara, T; Tominaga, N; Toyomura, J; Tachibana, T; Ide, Y; Ishikawa, H; Isolation and characterization of embryonic ameloblast lineage cells derived from tooth buds of fetal miniature swine. 52, 445-53 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Sheep 26698579

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.