| Product Number |
ARP59945_P050 |
| Product Page |
www.avivasysbio.com/adcyap1r1-antibody-c-terminal-region-arp59945-p050.html |
| Name |
Adcyap1r1 Antibody - C-terminal region (ARP59945_P050) |
| Protein Size (# AA) |
495 amino acids |
| Molecular Weight |
54kDa |
| NCBI Gene Id |
24167 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Adenylate cyclase activating polypeptide 1 receptor 1 |
| Description |
|
| Alias Symbols |
PAC1-R, PACAPR1, PACAP-R1, PACAPR1A, PACAP-R1A |
| Peptide Sequence |
Synthetic peptide located within the following region: GIIIILVQKLQSPDMGGNESSIYFSCVQKCYCKPQRAQQHSCKMSELSTI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Adcyap1r1 regulates neural precursor proliferation; mediates inhibitory signaling for Shh-induced cerebellar granule precursor cell proliferation. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Adcyap1r1 (ARP59945_P050) antibody |
| Blocking Peptide |
For anti-Adcyap1r1 (ARP59945_P050) antibody is Catalog # AAP59945 |
| Uniprot ID |
P32215-2 |
| Protein Name |
Pituitary adenylate cyclase-activating polypeptide type I receptor |
| Publications |
PACAP modulation of calcium ion activity in developing granule cells of the neonatal mouse olfactory bulb. J Neurophysiol. 113, 1234-48 (2015). 25475351 |
| Protein Accession # |
NP_598195 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_133511 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Adcyap1r1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
| Application |
WB, IHC, IHC-F |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Zebrafish: 93% |
| Image 1 | Rat Brain
 | WB Suggested Anti-Adcyap1r1 Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Brain |
|
|
