Product Number |
ARP59945_P050 |
Product Page |
https://www.avivasysbio.com/adcyap1r1-antibody-c-terminal-region-arp59945-p050.html |
Name |
Adcyap1r1 Antibody - C-terminal region (ARP59945_P050) |
Protein Size (# AA) |
495 amino acids |
Molecular Weight |
54kDa |
NCBI Gene Id |
24167 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Adenylate cyclase activating polypeptide 1 receptor 1 |
Description |
|
Alias Symbols |
PAC1-R, PACAPR1, PACAP-R1, PACAPR1A, PACAP-R1A |
Peptide Sequence |
Synthetic peptide located within the following region: GIIIILVQKLQSPDMGGNESSIYFSCVQKCYCKPQRAQQHSCKMSELSTI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Adcyap1r1 regulates neural precursor proliferation; mediates inhibitory signaling for Shh-induced cerebellar granule precursor cell proliferation. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Adcyap1r1 (ARP59945_P050) antibody |
Blocking Peptide |
For anti-Adcyap1r1 (ARP59945_P050) antibody is Catalog # AAP59945 |
Uniprot ID |
P32215-2 |
Protein Name |
Pituitary adenylate cyclase-activating polypeptide type I receptor |
Publications |
Mavis Irwin, Ann Greig, Petr Tvrdik, Mary T Lucero. PACAP modulation of calcium ion activity in developing granule cells of the neonatal mouse olfactory bulb.. J Neurophysiol. 113, 1234-48 (2015). ICC 25475351
|
Protein Accession # |
NP_598195 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_133511 |
Tested Species Reactivity |
Rat |
Gene Symbol |
Adcyap1r1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
Application |
WB, IHC, IHC-F |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Zebrafish: 93% |
Image 1 | Rat Brain
 | WB Suggested Anti-Adcyap1r1 Antibody Titration: 1.0 ug/ml Positive Control: Rat Brain |
|
|