Loading...
Catalog No: ARP59945_P050
Price: $0.00
SKU
ARP59945_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

Adcyap1r1 Antibody - C-terminal region (ARP59945_P050)

Rating:
80% of 100
Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-Adcyap1r1 (ARP59945_P050) antibody
Product Info
Tested Species ReactivityRat
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC, IHC-F
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: GIIIILVQKLQSPDMGGNESSIYFSCVQKCYCKPQRAQQHSCKMSELSTI
Concentration0.5 mg/ml
Blocking PeptideFor anti-Adcyap1r1 (ARP59945_P050) antibody is Catalog # AAP59945
Publications

PACAP modulation of calcium ion activity in developing granule cells of the neonatal mouse olfactory bulb. J Neurophysiol. 113, 1234-48 (2015). 25475351

Description
Gene SymbolAdcyap1r1
Gene Full NameAdenylate cyclase activating polypeptide 1 receptor 1
Alias SymbolsPAC1-R, PACAPR1, PACAP-R1, PACAPR1A, PACAP-R1A
NCBI Gene Id24167
Protein NamePituitary adenylate cyclase-activating polypeptide type I receptor
Description of TargetAdcyap1r1 regulates neural precursor proliferation; mediates inhibitory signaling for Shh-induced cerebellar granule precursor cell proliferation.
Uniprot IDP32215-2
Protein Accession #NP_598195
Nucleotide Accession #NM_133511
Protein Size (# AA)495
Molecular Weight54kDa
  1. What is the species homology for "Adcyap1r1 Antibody - C-terminal region (ARP59945_P050)"?

    The tested species reactivity for this item is "Rat". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish".

  2. How long will it take to receive "Adcyap1r1 Antibody - C-terminal region (ARP59945_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Adcyap1r1 Antibody - C-terminal region (ARP59945_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Adcyap1r1 Antibody - C-terminal region (ARP59945_P050)"?

    This target may also be called "PAC1-R, PACAPR1, PACAP-R1, PACAPR1A, PACAP-R1A" in publications.

  5. What is the shipping cost for "Adcyap1r1 Antibody - C-terminal region (ARP59945_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Adcyap1r1 Antibody - C-terminal region (ARP59945_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Adcyap1r1 Antibody - C-terminal region (ARP59945_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "54kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Adcyap1r1 Antibody - C-terminal region (ARP59945_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ADCYAP1R1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ADCYAP1R1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ADCYAP1R1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ADCYAP1R1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ADCYAP1R1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ADCYAP1R1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Adcyap1r1 Antibody - C-terminal region (ARP59945_P050)
Your Rating
We found other products you might like!