| Product Number |
ARP59943_P050 |
| Product Page |
www.avivasysbio.com/adam8-antibody-n-terminal-region-arp59943-p050.html |
| Name |
ADAM8 Antibody - N-terminal region (ARP59943_P050) |
| Protein Size (# AA) |
856 amino acids |
| Molecular Weight |
94kDa |
| NCBI Gene Id |
101 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
ADAM metallopeptidase domain 8 |
| Alias Symbols |
MS2, CD156, CD156a |
| Peptide Sequence |
Synthetic peptide located within the following region: LHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHVEGYPDSAA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene may be involved in cell adhesion during neurodegeneration, and it is thought to be a target for allergic respiratory diseases, including asthma. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ADAM8 (ARP59943_P050) antibody |
| Blocking Peptide |
For anti-ADAM8 (ARP59943_P050) antibody is Catalog # AAP59943 (Previous Catalog # AAPP46092) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ADAM8 |
| Uniprot ID |
P78325 |
| Protein Accession # |
NP_001100 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001109 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ADAM8 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Mouse: 79%; Rabbit: 79%; Rat: 79% |
| Image 1 | Human PANC1
 | WB Suggested Anti-ADAM8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: PANC1 cell lysate |
|
|
