Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ADAM8 antibody - N-terminal region (ARP59943_P050)

100 ul
In Stock

Conjugation Options

ARP59943_P050-FITC Conjugated

ARP59943_P050-HRP Conjugated

ARP59943_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
ADAM metallopeptidase domain 8
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CD156, MGC134985, MS2
Replacement Item:
This antibody may replace item sc-15499 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene may be involved in cell adhesion during neurodegeneration, and it is thought to be a target for allergic respiratory diseases, including asthma.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ADAM8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ADAM8.
The immunogen is a synthetic peptide directed towards the N terminal region of human ADAM8
Species Reactivity:
Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Mouse: 79%; Rabbit: 79%; Rat: 79%
Complete computational species homology data:
Anti-ADAM8 (ARP59943_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHVEGYPDSAA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ADAM8 (ARP59943_P050) antibody is Catalog # AAP59943 (Previous Catalog # AAPP46092)
Printable datasheet for anti-ADAM8 (ARP59943_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...