| Product Number |
ARP58746_P050 |
| Product Page |
www.avivasysbio.com/dppa5-antibody-n-terminal-region-arp58746-p050.html |
| Name |
DPPA5 Antibody - N-terminal region (ARP58746_P050) |
| Protein Size (# AA) |
116 amino acids |
| Molecular Weight |
13kDa |
| NCBI Gene Id |
340168 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Developmental pluripotency associated 5 |
| Alias Symbols |
ESG1 |
| Peptide Sequence |
Synthetic peptide located within the following region: MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Pierre,A., (2007) Genomics 90 (5), 583-594 |
| Description of Target |
DPPA5 is involved in the maintenance of embryonic stem (ES) cell pluripotency. DPPA5 is dispensable for self-renewal of pluripotent ES cells and establishment of germ cells. DPPA5 is associates with specific target mRNAs. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-DPPA5 (ARP58746_P050) antibody |
| Blocking Peptide |
For anti-DPPA5 (ARP58746_P050) antibody is Catalog # AAP58746 (Previous Catalog # AAPP38513) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human DPPA5 |
| Uniprot ID |
A6NC42 |
| Protein Name |
Developmental pluripotency-associated 5 protein |
| Protein Accession # |
NP_001020461 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001025290 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
DPPA5 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 92%; Human: 100%; Mouse: 100%; Pig: 79%; Rabbit: 93%; Rat: 92% |
| Image 1 | Human PANC1
 | WB Suggested Anti-DPPA5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: PANC1 cell lysate |
|
|
