- Tested Species Reactivity:
- Human
- Predicted Species Reactivity:
- Dog, Human, Mouse, Pig, Rabbit, Rat
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Application:
- WB
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Gene Symbol:
- DPPA5
- Official Gene Full Name:
- Developmental pluripotency associated 5
- NCBI Gene Id:
- 340168
- Protein Name:
- Developmental pluripotency-associated 5 protein
- Swissprot Id:
- A6NC42
- Protein Accession #:
- NP_001020461
- Nucleotide Accession #:
- NM_001025290
- Alias Symbols:
- Esg1, ESG1
- Replacement Item:
- This antibody may replace item sc-82864 from Santa Cruz Biotechnology.
- Description of Target:
- DPPA5 is involved in the maintenance of embryonic stem (ES) cell pluripotency. DPPA5 is dispensable for self-renewal of pluripotent ES cells and establishment of germ cells. DPPA5 is associates with specific target mRNAs.
- Protein Size (# AA):
- 116
- Molecular Weight:
- 13kDa
- Purification:
- Affinity Purified
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express DPPA5.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express DPPA5.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the N terminal region of human DPPA5
- Predicted Homology Based on Immunogen Sequence:
- Dog: 92%; Human: 100%; Mouse: 100%; Pig: 79%; Rabbit: 93%; Rat: 92%
- Complete computational species homology data:
- Anti-DPPA5 (ARP58746_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Blocking Peptide:
- For anti-DPPA5 (ARP58746_P050) antibody is Catalog # AAP58746 (Previous Catalog # AAPP38513)
- Datasheets/Manuals:
- Printable datasheet for anti-DPPA5 (ARP58746_P050) antibody
- Target Reference:
- Pierre,A., (2007) Genomics 90 (5), 583-594
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
