DPPA5 Antibody - N-terminal region (ARP58746_P050)

Catalog#: ARP58746_P050

• Size: 100 ul

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Dog, Human, Mouse, Pig, Rabbit, Rat
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Gene Symbol: DPPA5
• Official Gene Full Name: Developmental pluripotency associated 5
• NCBI Gene Id: 340168
• Protein Name: Developmental pluripotency-associated 5 protein
• Swissprot Id: A6NC42
• Protein Accession #: NP_001020461
• Nucleotide Accession #: NM_001025290
• Alias Symbols: Esg1, ESG1
• Replacement Item: This antibody may replace item sc-82864 from Santa Cruz Biotechnology.
• Description of Target: DPPA5 is involved in the maintenance of embryonic stem (ES) cell pluripotency. DPPA5 is dispensable for self-renewal of pluripotent ES cells and establishment of germ cells. DPPA5 is associates with specific target mRNAs.
• Protein Size (# AA): 116
• Molecular Weight: 13kDa
• Purification: Affinity Purified
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express DPPA5.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DPPA5
• Predicted Homology Based on Immunogen Sequence: Dog: 92%; Human: 100%; Mouse: 100%; Pig: 79%; Rabbit: 93%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-DPPA5 (ARP58746_P050) antibody is Catalog # AAP58746 (Previous Catalog # AAPP38513)
• Target Reference: Pierre,A., (2007) Genomics 90 (5), 583-594

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.

Product Protocols: DPPA5 antibody tested with Human Panc1 Cells (ARP58746_P050)