Search Antibody, Protein, and ELISA Kit Solutions

DPPA5 Antibody - N-terminal region (ARP58746_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58746_P050-FITC Conjugated

ARP58746_P050-HRP Conjugated

ARP58746_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Developmental pluripotency associated 5
NCBI Gene Id:
Protein Name:
Developmental pluripotency-associated 5 protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Esg1, ESG1
Replacement Item:
This antibody may replace item sc-82864 from Santa Cruz Biotechnology.
Description of Target:
DPPA5 is involved in the maintenance of embryonic stem (ES) cell pluripotency. DPPA5 is dispensable for self-renewal of pluripotent ES cells and establishment of germ cells. DPPA5 is associates with specific target mRNAs.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DPPA5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DPPA5.
The immunogen is a synthetic peptide directed towards the N terminal region of human DPPA5
Predicted Species Reactivity:
Dog, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Dog: 92%; Human: 100%; Mouse: 100%; Pig: 79%; Rabbit: 93%; Rat: 92%
Complete computational species homology data:
Anti-DPPA5 (ARP58746_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-DPPA5 (ARP58746_P050) antibody is Catalog # AAP58746 (Previous Catalog # AAPP38513)
Printable datasheet for anti-DPPA5 (ARP58746_P050) antibody
Target Reference:
Pierre,A., (2007) Genomics 90 (5), 583-594

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...