DPPA5 Antibody - N-terminal region (ARP58746_P050)

Catalog#: ARP58746_P050
Domestic: within 1-2 days delivery International: 1-2 days

Human PANC1

Size:	100 ul
Price:	$289.00
Availability: In Stock
Qty:
Request Bulk Order Quote

Aviva's Satisfaction Guarantee

Conjugation Options

ARP58746_P050-FITC Conjugated

ARP58746_P050-HRP Conjugated

ARP58746_P050-Biotin Conjugated

Gene Symbol:: DPPA5
Official Gene Full Name:: Developmental pluripotency associated 5
NCBI Gene Id:: 340168
Protein Name:: Developmental pluripotency-associated 5 protein
Swissprot Id:: A6NC42
Protein Accession #:: NP_001020461
Nucleotide Accession #:: NM_001025290
Alias Symbols:: Esg1, ESG1
Replacement Item:: This antibody may replace item sc-82864 from Santa Cruz Biotechnology.
Description of Target:: DPPA5 is involved in the maintenance of embryonic stem (ES) cell pluripotency. DPPA5 is dispensable for self-renewal of pluripotent ES cells and establishment of germ cells. DPPA5 is associates with specific target mRNAs.
Protein Size (# AA):: 116
Molecular Weight:: 13kDa
Host:: Rabbit
Clonality:: Polyclonal
Purification:: Affinity Purified
Application:: WB
Tissue Tool:: Find tissues and cell lines supported by DNA array analysis to express DPPA5.
RNA Seq:: Find tissues and cell lines supported by RNA-seq analysis to express DPPA5.
Immunogen:: The immunogen is a synthetic peptide directed towards the N terminal region of human DPPA5
Predicted Species Reactivity:: Dog, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:: Human
Predicted Homology Based on Immunogen Sequence:: Dog: 92%; Human: 100%; Mouse: 100%; Pig: 79%; Rabbit: 93%; Rat: 92%
Complete computational species homology data:: Anti-DPPA5 (ARP58746_P050)
Peptide Sequence:: Synthetic peptide located within the following region: MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV
Product Format:: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:: For anti-DPPA5 (ARP58746_P050) antibody is Catalog # AAP58746 (Previous Catalog # AAPP38513)
Datasheets/Manuals:: Printable datasheet for anti-DPPA5 (ARP58746_P050) antibody