| Product Number |
ARP58627_P050 |
| Product Page |
www.avivasysbio.com/adgrg1-antibody-n-terminal-region-arp58627-p050.html |
| Name |
ADGRG1 Antibody - N-terminal region (ARP58627_P050) |
| Protein Size (# AA) |
693 amino acids |
| Molecular Weight |
76kDa |
| NCBI Gene Id |
9289 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
adhesion G protein-coupled receptor G1 |
| Description |
|
| Alias Symbols |
BFPP, BPPR, GPR56, TM7LN4, TM7XN1 |
| Peptide Sequence |
Synthetic peptide located within the following region: MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ke,N., (2008) Biochem. Biophys. Res. Commun. 366 (2), 314-320 |
| Description of Target |
This gene encodes a member of the G protein-coupled receptor family and regulates brain cortical patterning. The encoded protein binds specifically to transglutaminase 2, a component of tissue and tumor stroma implicated as an inhibitor of tumor progression. Mutations in this gene are associated with a brain malformation known as bilateral frontoparietal polymicrogyria. Alternative splicing results in multiple transcript variants. |
| Protein Interactions |
ADRB2; UBC; ARRB2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ADGRG1 (ARP58627_P050) antibody |
| Blocking Peptide |
For anti-ADGRG1 (ARP58627_P050) antibody is Catalog # AAP58627 (Previous Catalog # AAPP35764) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GPR56 |
| Uniprot ID |
Q9Y653 |
| Protein Name |
adhesion G-protein coupled receptor G1 |
| Protein Accession # |
NP_005673 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_005682 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ADGRG1 |
| Predicted Species Reactivity |
Human, Rat, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Rabbit: 86%; Rat: 79% |
| Image 1 | Human HepG2
 | WB Suggested Anti-GPR56 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate |
|
|
